INSL5 antibody (Middle Region)
-
- Target See all INSL5 Antibodies
- INSL5 (Insulin-Like 5 (INSL5))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This INSL5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- INSL5 antibody was raised against the middle region of INSL5
- Purification
- Affinity purified
- Immunogen
- INSL5 antibody was raised using the middle region of INSL5 corresponding to a region with amino acids RTVIYICASSRWRRHQEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPK
- Top Product
- Discover our top product INSL5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
INSL5 Blocking Peptide, catalog no. 33R-8237, is also available for use as a blocking control in assays to test for specificity of this INSL5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INSL5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- INSL5 (Insulin-Like 5 (INSL5))
- Alternative Name
- INSL5 (INSL5 Products)
- Background
- The protein encoded by this gene contains a classical signature of the insulin superfamily and is highly similar to relaxin 3 (RLN3/INSL7).
- Molecular Weight
- 13 kDa (MW of target protein)
- Pathways
- Hormone Activity
-