Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

INSL5 antibody (Insulin-Like 5) (Middle Region) Primary Antibody

INSL5 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN632233
$672.32
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    INSL5
    Binding Specificity
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Middle Region
    Reactivity
    • 15
    • 10
    • 2
    Human
    Host
    • 16
    Rabbit
    Clonality
    • 16
    Polyclonal
    Conjugate
    • 9
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This INSL5 antibody is un-conjugated
    Application
    • 9
    • 4
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Specificity
    INSL5 antibody was raised against the middle region of INSL5
    Purification
    Affinity purified
    Immunogen
    INSL5 antibody was raised using the middle region of INSL5 corresponding to a region with amino acids RTVIYICASSRWRRHQEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPK
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    INSL5 Blocking Peptide, catalog no. 33R-8237, is also available for use as a blocking control in assays to test for specificity of this INSL5 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INSL5 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C/-20 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    INSL5
    Alternative Name
    INSL5 (INSL5 Antibody Abstract)
    Synonyms
    PRO182, UNQ156, RIF2, insulin like 5, insulin-like 5, INSL5, Insl5
    Background
    The protein encoded by this gene contains a classical signature of the insulin superfamily and is highly similar to relaxin 3 (RLN3/INSL7).
    Molecular Weight
    13 kDa (MW of target protein)
    Pathways
    Hormone Activity
You are here:
help Support