LIN37 antibody (Lin-37 Homolog (C. Elegans))

Details for Product anti-LIN37 Antibody No. ABIN632413
Target
Reactivity
Human
7
3
2
2
2
2
2
1
1
1
1
Host
Rabbit
7
Clonality
Polyclonal
Conjugate
This LIN37 antibody is un-conjugated
1
1
1
Application
Western Blotting (WB)
4
3
1
Options
Immunogen LIN37 antibody was raised using a synthetic peptide corresponding to a region with amino acids HQRRKKRREMDDGLAEGGPQRSNTYVIKLFDRSVDLAQFSENTPLYPICR
Purification Affinity purified
Target
Alternative Name LIN37 (LIN37 Antibody Abstract)
Background This gene encodes a protein expressed in the eye.
Molecular Weight 28 kDa (MW of target protein)
Pathways Cell Division Cycle, Mitotic G1-G1/S Phases
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

LIN37 Blocking Peptide, catalog no. 33R-3828, is also available for use as a blocking control in assays to test for specificity of this LIN37 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIN37 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Images
Image no. 1 for anti-Lin-37 Homolog (C. Elegans) (LIN37) antibody (ABIN632413) LIN37 antibody used at 1 ug/ml to detect target protein.