LIN37 antibody

Catalog No. ABIN632413

Product Details anti-LIN37 Antibody

Target: LIN37 (Lin-37 Homolog (LIN37))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LIN37 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: LIN37 antibody was raised using a synthetic peptide corresponding to a region with amino acids HQRRKKRREMDDGLAEGGPQRSNTYVIKLFDRSVDLAQFSENTPLYPICR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LIN37 Blocking Peptide, catalog no. 33R-3828, is also available for use as a blocking control in assays to test for specificity of this LIN37 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIN37 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LIN37

Target: LIN37 (Lin-37 Homolog (LIN37))

Alternative Name: LIN37 (LIN37 Products)

Synonyms: F25965 antibody, ZK418.4 antibody, lin-37 antibody, 1810054G18Rik antibody, lin-37 DREAM MuvB core complex component antibody, lin-37 homolog (C. elegans) antibody, LIN37 antibody, Lin37 antibody

Background: This gene encodes a protein expressed in the eye.

Molecular Weight: 28 kDa (MW of target protein)

Pathways: Cell Division Cycle, Mitotic G1-G1/S Phases