Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

LIN37 antibody (Lin-37 Homolog (C. Elegans)) Primary Antibody

LIN37 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN632413
$647.32
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    LIN37
    Reactivity
    Human
    • 7
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Host
    Rabbit
    Clonality
    Polyclonal
    Conjugate
    This LIN37 antibody is un-conjugated
    • 4
    • 1
    • 1
    • 1
    Application
    Western Blotting (WB)
    • 4
    • 3
    • 1
    Purification
    Affinity purified
    Immunogen
    LIN37 antibody was raised using a synthetic peptide corresponding to a region with amino acids HQRRKKRREMDDGLAEGGPQRSNTYVIKLFDRSVDLAQFSENTPLYPICR
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    LIN37 Blocking Peptide, catalog no. 33R-3828, is also available for use as a blocking control in assays to test for specificity of this LIN37 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIN37 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Storage
    4 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    LIN37
    Alternative Name
    LIN37 (LIN37 Antibody Abstract)
    Synonyms
    F25965, ZK418.4, lin-37, 1810054G18Rik, lin-37 DREAM MuvB core complex component, lin-37 homolog (C. elegans), LIN37, Lin37
    Background
    This gene encodes a protein expressed in the eye.
    Molecular Weight
    28 kDa (MW of target protein)
    Pathways
    Cell Division Cycle, Mitotic G1-G1/S Phases
You are here:
help Support