-
- Target See all RIC8A Antibodies
- RIC8A (Resistance To Inhibitors of Cholinesterase 8 Homolog A (C. Elegans) (RIC8A))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RIC8A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- RIC8 A antibody was raised using a synthetic peptide corresponding to a region with amino acids KLTERVGLYRERSFPHDVQFFDLRLLFLLTALRTDVRQQLFQELKGVRLL
- Top Product
- Discover our top product RIC8A Primary Antibody
-
anti-Resistance To Inhibitors of Cholinesterase 8 Homolog A (C. Elegans) (RIC8A) (AA 462-534) antibody
RIC8A Reactivity: Human WB, ELISA Host: Mouse Monoclonal 1H6 unconjugated
anti-Resistance To Inhibitors of Cholinesterase 8 Homolog A (C. Elegans) (RIC8A) (C-Term) antibodyRIC8A Reactivity: Human WB, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Resistance To Inhibitors of Cholinesterase 8 Homolog A (C. Elegans) (RIC8A) antibodyRIC8A Reactivity: Human, Mouse, Rat WB Host: Rabbit Polyclonal unconjugated
anti-Resistance To Inhibitors of Cholinesterase 8 Homolog A (C. Elegans) (RIC8A) (AA 362-531) antibodyRIC8A Reactivity: Human ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-Resistance To Inhibitors of Cholinesterase 8 Homolog A (C. Elegans) (RIC8A) (AA 244-272) antibodyRIC8A Reactivity: Human WB Host: Rabbit Polyclonal RB37066 unconjugated
anti-Resistance To Inhibitors of Cholinesterase 8 Homolog A (C. Elegans) (RIC8A) antibodyRIC8A Reactivity: Human, Mouse, Rat ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-Resistance To Inhibitors of Cholinesterase 8 Homolog A (C. Elegans) (RIC8A) (C-Term) antibodyVerified RIC8A Reactivity: Human WB, ELISA Host: Goat Polyclonal unconjugated
anti-Resistance To Inhibitors of Cholinesterase 8 Homolog A (C. Elegans) (RIC8A) (AA 143-192) antibodyRIC8A Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Monkey WB Host: Rabbit Polyclonal unconjugated
anti-Resistance To Inhibitors of Cholinesterase 8 Homolog A (C. Elegans) (RIC8A) (AA 362-531) antibodyRIC8A Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
anti-Resistance To Inhibitors of Cholinesterase 8 Homolog A (C. Elegans) (RIC8A) (N-Term) antibodyRIC8A Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit WB Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RIC8A Blocking Peptide, catalog no. 33R-4543, is also available for use as a blocking control in assays to test for specificity of this RIC8A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RIC0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RIC8A (Resistance To Inhibitors of Cholinesterase 8 Homolog A (C. Elegans) (RIC8A))
- Alternative Name
- RIC8A (RIC8A Products)
- Background
- RIC8A is a guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins.RIC8A is able to activate GNAI1, GNAO1 and GNAQ, but not GNAS by exchanging bound GDP for free GTP.RIC8A is involved in regulation of microtubule pulling forces during mitotic movement of chromosomes by stimulating G(i)-alpha protein, possibly leading to release G(i)-alpha-GTP and NuMA proteins from the NuMA-GPSM2-G(i)-alpha-GDP complex. RIC8A also acts as an activator for G(q)-alpha (GNAQ) protein by enhancing the G(q)-coupled receptor-mediated ERK activation.
- Molecular Weight
- 60 kDa (MW of target protein)
- Pathways
- Regulation of G-Protein Coupled Receptor Protein Signaling, Feeding Behaviour, Asymmetric Protein Localization
-
You are here:
