RIC8A antibody

Catalog No. ABIN633084

This anti-RIC8A antibody is a Rabbit Polyclonal antibody detecting RIC8A in WB. Suitable for Human.

Quick Overview for RIC8A antibody (ABIN633084)

Target: RIC8A (Resistance To Inhibitors of Cholinesterase 8 Homolog A (C. Elegans) (RIC8A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RIC8A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RIC8A Antibody

Purification: Affinity purified

Immunogen: RIC8 A antibody was raised using a synthetic peptide corresponding to a region with amino acids KLTERVGLYRERSFPHDVQFFDLRLLFLLTALRTDVRQQLFQELKGVRLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RIC8A Blocking Peptide, (ABIN939929), is also available for use as a blocking control in assays to test for specificity of this RIC8A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RIC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RIC8A

Target: RIC8A (Resistance To Inhibitors of Cholinesterase 8 Homolog A (C. Elegans) (RIC8A))

Alternative Name: RIC8A

Background: RIC8A is a guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins.RIC8A is able to activate GNAI1, GNAO1 and GNAQ, but not GNAS by exchanging bound GDP for free GTP.RIC8A is involved in regulation of microtubule pulling forces during mitotic movement of chromosomes by stimulating G(i)-alpha protein, possibly leading to release G(i)-alpha-GTP and NuMA proteins from the NuMA-GPSM2-G(i)-alpha-GDP complex. RIC8A also acts as an activator for G(q)-alpha (GNAQ) protein by enhancing the G(q)-coupled receptor-mediated ERK activation.

Molecular Weight: 60 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling, Feeding Behaviour, Asymmetric Protein Localization