ADAMTS18 antibody (N-Term)
-
- Target See all ADAMTS18 Antibodies
- ADAMTS18 (ADAM Metallopeptidase with thrombospondin Type 1 Motif, 18 (ADAMTS18))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ADAMTS18 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ADAMTS18 antibody was raised against the N terminal of ADAMTS18
- Purification
- Affinity purified
- Immunogen
- ADAMTS18 antibody was raised using the N terminal of ADAMTS18 corresponding to a region with amino acids FYQGFIRNDSSSSVAVSTCAGLSGLIRTRKNEFLISPLPQLLAQEHNYSS
- Top Product
- Discover our top product ADAMTS18 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ADAMTS18 Blocking Peptide, catalog no. 33R-3140, is also available for use as a blocking control in assays to test for specificity of this ADAMTS18 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAMTS18 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADAMTS18 (ADAM Metallopeptidase with thrombospondin Type 1 Motif, 18 (ADAMTS18))
- Alternative Name
- ADAMTS18 (ADAMTS18 Products)
- Background
- ADAMTS18 is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains.
- Molecular Weight
- 104 kDa (MW of target protein)
-