ADAM Metallopeptidase with thrombospondin Type 1 Motif, 18 (ADAMTS18) (N-Term) antibody

Details for Product No. ABIN633175
Target
Binding Specificity
N-Term
9
8
2
1
1
1
1
Reactivity
Human, Mouse
33
24
4
2
2
2
2
1
1
1
1
Host
Rabbit
31
2
Clonality
Polyclonal
Conjugate
Un-conjugated
3
2
2
2
2
2
1
1
1
1
1
1
Application
Western Blotting (WB)
27
20
4
3
2
1
1
Options
Immunogen ADAMTS18 antibody was raised using the N terminal of ADAMTS18 corresponding to a region with amino acids FYQGFIRNDSSSSVAVSTCAGLSGLIRTRKNEFLISPLPQLLAQEHNYSS
Specificity ADAMTS18 antibody was raised against the N terminal of ADAMTS18
Purification Affinity purified
Target
Alternative Name ADAMTS18 (ADAMTS18 Antibody Abstract)
Background ADAMTS18 is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains.
Molecular Weight 104 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

ADAMTS18 Blocking Peptide, catalog no. 33R-3140, is also available for use as a blocking control in assays to test for specificity of this ADAMTS18 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAMTS18 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Images
Image no. 1 for anti-ADAM Metallopeptidase with thrombospondin Type 1 Motif, 18 (ADAMTS18) (N-Term) antibody (ABIN633175) ADAMTS18 antibody used at 1 ug/ml to detect target protein.