ISG20 antibody (Middle Region)
-
- Target See all ISG20 Antibodies
- ISG20 (Interferon Stimulated Exonuclease Gene 20kDa (ISG20))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ISG20 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ISG20 antibody was raised against the middle region of ISG20
- Purification
- Affinity purified
- Immunogen
- ISG20 antibody was raised using the middle region of ISG20 corresponding to a region with amino acids TSTDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATM
- Top Product
- Discover our top product ISG20 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ISG20 Blocking Peptide, catalog no. 33R-9301, is also available for use as a blocking control in assays to test for specificity of this ISG20 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ISG20 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ISG20 (Interferon Stimulated Exonuclease Gene 20kDa (ISG20))
- Alternative Name
- ISG20 (ISG20 Products)
- Synonyms
- ISG20 antibody, CD25 antibody, HEM45 antibody, 1600023I01Rik antibody, 2010107M23Rik antibody, 20kDa antibody, DnaQL antibody, interferon stimulated exonuclease gene 20 antibody, interferon-stimulated protein antibody, ISG20 antibody, Isg20 antibody
- Background
- ISG20 belongs to the the exonuclease superfamily. It is exonuclease with specificity for single-stranded RNA and, to a lesser extent for DNA. It degrades RNA at a rate that is approximately 35-fold higher than its rate for single-stranded DNA. It is involved in the antiviral function of IFN against RNA viruses.
- Molecular Weight
- 20 kDa (MW of target protein)
-