Potassium Voltage-Gated Channel, Subfamily G, Member 1 (KCNG1) (N-Term) antibody

Catalog No. ABIN633693

Product Details

Target: Potassium Voltage-Gated Channel, Subfamily G, Member 1 (KCNG1)

See all Potassium Voltage-Gated Channel, Subfamily G, Member 1 (KCNG1) Antibodies

Binding Specificity: N-Term

See all available epitopes across KCNG1 antibodies

• N-Term 3
• AA 108-157 1
• C-Term 1

Reactivity: Human, Mouse, Rat

See all available reactivities across KCNG1 antibodies

• Human 26
• Mouse 21
• Rat 21
• Cow 3
• Guinea Pig 3
• Horse 2
• Monkey 2
• Pig 2
• Rabbit 2
• Bat 1
• Dog 1

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

See all available conjugates across KCNG1 antibodies

• Un-conjugated 10
• Alexa Fluor 750 2
• Biotin 2
• Alexa Fluor 350 1
• Alexa Fluor 488 1
• Alexa Fluor 555 1
• Alexa Fluor 594 1
• Alexa Fluor 647 1
• Alexa Fluor 680 1
• Cy3 1
• Cy5 1
• Cy5.5 1
• Cy7 1
• FITC 1
• HRP 1

Application: Western Blotting (WB)

See all available applications across KCNG1 antibodies

• Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13
• Western Blotting (WB) 12
• Immunohistochemistry (IHC) 5
• Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 5
• ELISA 4
• Flow Cytometry (FACS) 1
• Immunofluorescence (IF) 1

Specificity: KCNG1 antibody was raised against the N terminal of KCNG1

Purification: Affinity purified

Immunogen: KCNG1 antibody was raised using the N terminal of KCNG1 corresponding to a region with amino acids YDVTCNEFFFDRNPGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNG1 Blocking Peptide, catalog no. 33R-10077, is also available for use as a blocking control in assays to test for specificity of this KCNG1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Potassium Voltage-Gated Channel, Subfamily G, Member 1 (KCNG1)

Alternative Name: KCNG1 (KCNG1 Antibody Abstract)

Synonyms: kcng1, MGC122787, K13, KCNG, KV6.1, kH2, AW536275, OTTMUSG00000016048, Kh2, Kv6.1, potassium channel, voltage gated modifier subfamily G, member 1, potassium voltage-gated channel modifier subfamily G member 1, potassium voltage-gated channel, subfamily G, member 1, kcng1, KCNG1, Kcng1

Background: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNG1 is a member of the potassium channel, voltage-gated, subfamily G. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.

Molecular Weight: 58 kDa (MW of target protein)