Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Potassium Voltage-Gated Channel, Subfamily G, Member 1 (KCNG1) (N-Term) antibody Primary Antibody

KCNG1 Reactivity: Human, Mouse, Rat WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN633693
$647.32
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    Potassium Voltage-Gated Channel, Subfamily G, Member 1 (KCNG1)
    Binding Specificity
    N-Term
    • 3
    • 1
    • 1
    Reactivity
    Human, Mouse, Rat
    • 26
    • 21
    • 21
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    Host
    Rabbit
    Clonality
    Polyclonal
    Conjugate
    Un-conjugated
    • 10
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Application
    Western Blotting (WB)
    • 13
    • 12
    • 5
    • 5
    • 4
    • 1
    • 1
    Specificity
    KCNG1 antibody was raised against the N terminal of KCNG1
    Purification
    Affinity purified
    Immunogen
    KCNG1 antibody was raised using the N terminal of KCNG1 corresponding to a region with amino acids YDVTCNEFFFDRNPGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIA
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    KCNG1 Blocking Peptide, catalog no. 33R-10077, is also available for use as a blocking control in assays to test for specificity of this KCNG1 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNG1 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    Potassium Voltage-Gated Channel, Subfamily G, Member 1 (KCNG1)
    Alternative Name
    KCNG1 (KCNG1 Antibody Abstract)
    Synonyms
    kcng1, MGC122787, K13, KCNG, KV6.1, kH2, AW536275, OTTMUSG00000016048, Kh2, Kv6.1, potassium channel, voltage gated modifier subfamily G, member 1, potassium voltage-gated channel modifier subfamily G member 1, potassium voltage-gated channel, subfamily G, member 1, kcng1, KCNG1, Kcng1
    Background
    Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNG1 is a member of the potassium channel, voltage-gated, subfamily G. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.
    Molecular Weight
    58 kDa (MW of target protein)
You are here:
help Support