Potassium Voltage-Gated Channel, Subfamily G, Member 1 (KCNG1) (N-Term) antibody

Details for Product No. ABIN633693
Target
Binding Specificity
N-Term
3
1
1
Reactivity
Human, Mouse, Rat
26
21
21
3
3
2
2
2
2
1
1
Host
Rabbit
26
Clonality
Polyclonal
Conjugate
Un-conjugated
2
2
1
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
13
12
5
5
4
1
1
Options
Immunogen KCNG1 antibody was raised using the N terminal of KCNG1 corresponding to a region with amino acids YDVTCNEFFFDRNPGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIA
Specificity KCNG1 antibody was raised against the N terminal of KCNG1
Purification Affinity purified
Target
Alternative Name KCNG1 (KCNG1 Antibody Abstract)
Background Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNG1 is a member of the potassium channel, voltage-gated, subfamily G. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.
Molecular Weight 58 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

KCNG1 Blocking Peptide, catalog no. 33R-10077, is also available for use as a blocking control in assays to test for specificity of this KCNG1 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNG1 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Images
Image no. 1 for anti-Potassium Voltage-Gated Channel, Subfamily G, Member 1 (KCNG1) (N-Term) antibody (ABIN633693) KCNG1 antibody used at 1 ug/ml to detect target protein.