KCNG1 antibody (N-Term)

Catalog No. ABIN633688

This Rabbit Polyclonal antibody specifically detects KCNG1 in WB. It exhibits reactivity toward Human.

Quick Overview for KCNG1 antibody (N-Term) (ABIN633688)

Target: KCNG1 (Potassium Voltage-Gated Channel, Subfamily G, Member 1 (KCNG1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNG1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KCNG1 Antibody

Binding Specificity: N-Term

Specificity: KCNG1 antibody was raised against the N terminal of KCNG1

Purification: Affinity purified

Immunogen: KCNG1 antibody was raised using the N terminal of KCNG1 corresponding to a region with amino acids MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQD

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNG1 Blocking Peptide, (ABIN5614268), is also available for use as a blocking control in assays to test for specificity of this KCNG1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNG1

Target: KCNG1 (Potassium Voltage-Gated Channel, Subfamily G, Member 1 (KCNG1))

Alternative Name: KCNG1

Background: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNG1 is a member of the potassium channel, voltage-gated, subfamily G.

Molecular Weight: 56 kDa (MW of target protein)