IFNA5 antibody (Middle Region)
-
- Target See all IFNA5 Antibodies
- IFNA5 (Interferon, alpha 5 (IFNA5))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IFNA5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- IFN Alpha 5 antibody was raised against the middle region of IFNA5
- Purification
- Affinity purified
- Immunogen
- IFN Alpha 5 antibody was raised using the middle region of IFNA5 corresponding to a region with amino acids TELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKY
- Top Product
- Discover our top product IFNA5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IFN Alpha 5 Blocking Peptide, catalog no. 33R-9048, is also available for use as a blocking control in assays to test for specificity of this IFN Alpha 5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFNA5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IFNA5 (Interferon, alpha 5 (IFNA5))
- Alternative Name
- IFN alpha 5 (IFNA5 Products)
- Background
- Alpha interferon suppresses the cyclin D3 and cdc25A genes, leading to a reversible G0-like arrest.
- Molecular Weight
- 20 kDa (MW of target protein)
- Pathways
- JAK-STAT Signaling, Hepatitis C
-