IFNA5 antibody (Middle Region)

Catalog No. ABIN633933

Product Details anti-IFNA5 Antibody

Target: IFNA5 (Interferon, alpha 5 (IFNA5))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IFNA5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IFN Alpha 5 antibody was raised against the middle region of IFNA5

Purification: Affinity purified

Immunogen: IFN Alpha 5 antibody was raised using the middle region of IFNA5 corresponding to a region with amino acids TELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IFN Alpha 5 Blocking Peptide, catalog no. 33R-9048, is also available for use as a blocking control in assays to test for specificity of this IFN Alpha 5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFNA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IFNA5

Target: IFNA5 (Interferon, alpha 5 (IFNA5))

Alternative Name: IFN alpha 5 (IFNA5 Products)

Synonyms: IFN-alpha-5 antibody, IFN-alphaG antibody, INA5 antibody, INFA5 antibody, leIF G antibody, Ifa5 antibody, IFN-ALPHA-5 antibody, interferon alpha 5 antibody, interferon, alpha 5 antibody, interferon alpha family, gene 5 antibody, IFNA5 antibody, Ifna5 antibody, IFN-ALPHA-5 antibody

Background: Alpha interferon suppresses the cyclin D3 and cdc25A genes, leading to a reversible G0-like arrest.

Molecular Weight: 20 kDa (MW of target protein)

Pathways: JAK-STAT Signaling, Hepatitis C