RHOU antibody (C-Term)

Catalog No. ABIN634330

Product Details anti-RHOU Antibody

Target: RHOU (Ras Homolog Gene Family, Member U (RHOU))

Binding Specificity: C-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RHOU antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RHOU antibody was raised against the C terminal of RHOU

Purification: Affinity purified

Immunogen: RHOU antibody was raised using the C terminal of RHOU corresponding to a region with amino acids LKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RHOU Blocking Peptide, catalog no. 33R-5086, is also available for use as a blocking control in assays to test for specificity of this RHOU antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOU antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RHOU

Target: RHOU (Ras Homolog Gene Family, Member U (RHOU))

Alternative Name: RHOU (RHOU Products)

Background: RHOU is a member of the Rho family of GTPases. It can activate PAK1 and JNK1, and can induce filopodium formation and stress fiber dissolution. It may also mediate the effects of WNT1 signaling in the regulation of cell morphology, cytoskeletal organization, and cell proliferation.

Molecular Weight: 28 kDa (MW of target protein)