Protocadherin gamma Subfamily A, 4 (PCDHGA4) (N-Term) antibody

Details for Product No. ABIN634712
Antigen
Epitope
N-Term
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
4
3
2
1
1
1
1
1
Host
Rabbit
3
1
Clonality
Polyclonal
Application
Western Blotting (WB)
4
1
Options
Immunogen PCDHGA4 antibody was raised using the N terminal of PCDHGA4 corresponding to a region with amino acids GDPVRSGTARILIILVDTNDNAPVFTQPEYHVSVRENVPVGTRLLTVKAT
Specificity PCDHGA4 antibody was raised against the N terminal of PCDHGA4
Purification Affinity purified
Antigen
Alternative Name PCDHGA4 (PCDHGA4 Antibody Abstract)
Background PCDHGA4 is a single-pass type I membrane protein. It contains 6 cadherin domains. PCDHGA4 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.
Molecular Weight 86 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

PCDHGA4 Blocking Peptide, catalog no. 33R-3205, is also available for use as a blocking control in assays to test for specificity of this PCDHGA4 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHGA4 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Protocadherin gamma Subfamily A, 4 (PCDHGA4) (N-Term) antibody (ABIN634712) PCDHGA4 antibody used at 1 ug/ml to detect target protein.