STEAP Family Member 3, Metalloreductase (STEAP3) (C-Term) antibody

Details for Product No. ABIN634853
Antigen
Epitope
C-Term
12
11
8
8
4
1
1
1
1
Reactivity
Human
62
31
30
4
3
3
3
2
2
1
1
Host
Rabbit
62
Clonality
Polyclonal
Conjugate
Un-conjugated
4
3
3
2
2
2
1
1
1
1
1
1
Application
Western Blotting (WB)
54
32
20
9
8
3
3
2
1
1
1
1
Options
Immunogen STEAP3 antibody was raised using the C terminal of STEAP3 corresponding to a region with amino acids VALVLSTLHTLTYGWTRAFEESRYKFYLPPTFTLTLLVPCVVILAKALFL
Specificity STEAP3 antibody was raised against the C terminal of STEAP3
Purification Affinity purified
Antigen
Alternative Name STEAP3 (STEAP3 Antibody Abstract)
Background AS an endosomal ferrireductase, STEAP3 is required for efficient transferrin-dependent iron uptake in erythroid cells. It participates in erythroid iron homeostasis by reducing Fe(3+) to Fe(2+) and can also reduce of Cu(2+) to Cu(1+), suggesting that it participates in copper homeostasis. STEAP3 uses NAD(+) as acceptor (By similarity). It may play a role downstream of p53/TP53 to interface apoptosis and cell cycle progression. STEAP3 is indirectly involved in exosome secretion by facilitating the secretion of proteins such as TCT.
Molecular Weight 56 kDa (MW of target protein)
Pathways Transition Metal Ion Homeostasis
Application Notes WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.
Comment

STEAP3 Blocking Peptide, catalog no. 33R-9427, is also available for use as a blocking control in assays to test for specificity of this STEAP3 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STEAP3 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-STEAP Family Member 3, Metalloreductase (STEAP3) (C-Term) antibody (ABIN634853) STEAP3 antibody used at 0.25 ug/ml to detect target protein.