STEAP3 antibody (C-Term)

Catalog No. ABIN634853

Product Details anti-STEAP3 Antibody

Target: STEAP3 (STEAP Family Member 3, Metalloreductase (STEAP3))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STEAP3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: STEAP3 antibody was raised against the C terminal of STEAP3

Purification: Affinity purified

Immunogen: STEAP3 antibody was raised using the C terminal of STEAP3 corresponding to a region with amino acids VALVLSTLHTLTYGWTRAFEESRYKFYLPPTFTLTLLVPCVVILAKALFL

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

STEAP3 Blocking Peptide, catalog no. 33R-9427, is also available for use as a blocking control in assays to test for specificity of this STEAP3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STEAP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for STEAP3

Target: STEAP3 (STEAP Family Member 3, Metalloreductase (STEAP3))

Alternative Name: STEAP3 (STEAP3 Products)

Synonyms: STEAP3 antibody, 1010001D01Rik antibody, Tsap6 antibody, pHyde antibody, AHMIO2 antibody, STMP3 antibody, TSAP6 antibody, dudlin-2 antibody, STEAP3 metalloreductase antibody, STEAP family member 3 antibody, STEAP3 antibody, steap3 antibody, Steap3 antibody

Background: AS an endosomal ferrireductase, STEAP3 is required for efficient transferrin-dependent iron uptake in erythroid cells. It participates in erythroid iron homeostasis by reducing Fe(3+) to Fe(2+) and can also reduce of Cu(2+) to Cu(1+), suggesting that it participates in copper homeostasis. STEAP3 uses NAD(+) as acceptor (By similarity). It may play a role downstream of p53/TP53 to interface apoptosis and cell cycle progression. STEAP3 is indirectly involved in exosome secretion by facilitating the secretion of proteins such as TCT.

Molecular Weight: 56 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis