DISP1 antibody

Catalog No. ABIN634914

Product Details anti-DISP1 Antibody

Target: DISP1 (Dispatched Homolog 1 (DISP1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DISP1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DISP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVLCDVWNYTKFDKPHAETSETVSITLQHAALSMFVTSFTTAAAFYANYV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DISP1 Blocking Peptide, catalog no. 33R-3115, is also available for use as a blocking control in assays to test for specificity of this DISP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DISP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DISP1

Target: DISP1 (Dispatched Homolog 1 (DISP1))

Alternative Name: DISP1 (DISP1 Products)

Synonyms: DISP1 antibody, DISPA antibody, 1190008H24Rik antibody, DispA antibody, con antibody, zgc:111866 antibody, dispatched antibody, dispatched RND transporter family member 1 antibody, dispatched homolog 1 (Drosophila) antibody, CpipJ_CPIJ008642 antibody, DISP1 antibody, Disp1 antibody, disp1 antibody

Background: DISP1 functions in hedgehog (Hh) signaling. Regulates the release and extracellular accumulation of cholesterol-modified hedgehog proteins and is hence required for effective production of the Hh signal. The pattern of cellular proliferation and differentiation that leads to normal development of embryonic structures often depends upon the localized production of secreted protein signals. Cells surrounding the source of a particular signal respond in a graded manner according to the effective concentration of the signal, and this response produces the pattern of cell types constituting the mature structure.

Molecular Weight: 171 kDa (MW of target protein)

Pathways: Hedgehog Signaling