DISP1 antibody (Dispatched Homolog 1 (Drosophila))

Details for Product anti-DISP1 Antibody No. ABIN634914
Antigen
Reactivity
Human
24
10
2
2
2
1
1
1
1
Host
Rabbit
19
7
Clonality
Polyclonal
Conjugate
This DISP1 antibody is un-conjugated
1
1
1
1
1
1
Application
Western Blotting (WB)
25
16
6
5
4
1
1
Options
Immunogen DISP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVLCDVWNYTKFDKPHAETSETVSITLQHAALSMFVTSFTTAAAFYANYV
Purification Affinity purified
Antigen
Alternative Name DISP1 (DISP1 Antibody Abstract)
Background DISP1 functions in hedgehog (Hh) signaling. Regulates the release and extracellular accumulation of cholesterol-modified hedgehog proteins and is hence required for effective production of the Hh signal. The pattern of cellular proliferation and differentiation that leads to normal development of embryonic structures often depends upon the localized production of secreted protein signals. Cells surrounding the source of a particular signal respond in a graded manner according to the effective concentration of the signal, and this response produces the pattern of cell types constituting the mature structure.
Molecular Weight 171 kDa (MW of target protein)
Pathways Hedgehog Signaling
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

DISP1 Blocking Peptide, catalog no. 33R-3115, is also available for use as a blocking control in assays to test for specificity of this DISP1 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DISP1 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Dispatched Homolog 1 (Drosophila) (DISP1) antibody (ABIN634914) DISP1 antibody used at 1 ug/ml to detect target protein.