MUC3B antibody (N-Term)
-
- Target See all MUC3B products
- MUC3B (Mucin 3B, Cell Surface Associated (MUC3B))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MUC3B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MUC3 B antibody was raised against the N terminal of MUC3
- Purification
- Affinity purified
- Immunogen
- MUC3 B antibody was raised using the N terminal of MUC3 corresponding to a region with amino acids MLCADVVETEVGMEVSVDQQFSPDLNDNTSQAYRDFNKTFWNQMQKIFAD
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MUC3B Blocking Peptide, catalog no. 33R-6182, is also available for use as a blocking control in assays to test for specificity of this MUC3B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MUC0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MUC3B (Mucin 3B, Cell Surface Associated (MUC3B))
- Alternative Name
- MUC3B (MUC3B Products)
- Background
- MUC3B is major glycoprotein component of a variety of mucus gels. It is thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.
- Molecular Weight
- 35 kDa (MW of target protein)
-