Mucin 3B, Cell Surface Associated (MUC3B) (N-Term) antibody

Details for Product No. ABIN634921
Antigen
Epitope
N-Term
9
9
8
7
3
2
1
1
1
1
Reactivity
Human
31
2
2
2
1
1
1
1
1
Host
Rabbit
31
Clonality
Polyclonal
Conjugate
Un-conjugated
2
2
2
2
2
2
Application
Western Blotting (WB)
30
18
17
3
1
1
Options
Immunogen MUC3 B antibody was raised using the N terminal of MUC3 corresponding to a region with amino acids MLCADVVETEVGMEVSVDQQFSPDLNDNTSQAYRDFNKTFWNQMQKIFAD
Specificity MUC3 B antibody was raised against the N terminal of MUC3
Purification Affinity purified
Antigen
Alternative Name MUC3B
Background MUC3B is major glycoprotein component of a variety of mucus gels. It is thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.
Molecular Weight 35 kDa (MW of target protein)
Application Notes WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.
Comment

MUC3B Blocking Peptide, catalog no. 33R-6182, is also available for use as a blocking control in assays to test for specificity of this MUC3B antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MUC0 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Mucin 3B, Cell Surface Associated (MUC3B) (N-Term) antibody (ABIN634921) MUC3B antibody used at 0.5 ug/ml to detect target protein.