ABCC8 antibody

Catalog No. ABIN635259

Product Details anti-ABCC8 Antibody

Target: ABCC8 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 8 (ABCC8))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABCC8 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ABCC8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ABCC8 Blocking Peptide, catalog no. 33R-7184, is also available for use as a blocking control in assays to test for specificity of this ABCC8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCC8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ABCC8

Target: ABCC8 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 8 (ABCC8))

Alternative Name: ABCC8 (ABCC8 Products)

Synonyms: ABC36 antibody, HHF1 antibody, HI antibody, HRINS antibody, MRP8 antibody, PHHI antibody, SUR antibody, SUR1 antibody, SUR1delta2 antibody, TNDM2 antibody, D930031B21Rik antibody, Sur antibody, Sur1 antibody, ATP binding cassette subfamily C member 8 antibody, ATP-binding cassette, sub-family C (CFTR/MRP), member 8 antibody, ABCC8 antibody, Abcc8 antibody

Background: ABCC8 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). ABCC8 is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion.

Molecular Weight: 177 kDa (MW of target protein)

Pathways: Negative Regulation of Hormone Secretion