ABCC8 antibody (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 8)

Details for Product anti-ABCC8 Antibody No. ABIN635259
Antigen
Reactivity
Human, Mouse (Murine), Rat (Rattus)
72
41
37
25
2
2
2
2
1
1
1
1
Host
Rabbit
40
33
7
Clonality
Polyclonal
Conjugate
This ABCC8 antibody is un-conjugated
5
4
4
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
65
43
30
29
26
5
5
2
1
1
1
1
Options
Immunogen ABCC8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW
Purification Affinity purified
Antigen
Alternative Name ABCC8 (ABCC8 Antibody Abstract)
Background ABCC8 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). ABCC8 is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion.
Molecular Weight 177 kDa (MW of target protein)
Pathways Negative Regulation of Hormone Secretion
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

ABCC8 Blocking Peptide, catalog no. 33R-7184, is also available for use as a blocking control in assays to test for specificity of this ABCC8 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCC8 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.