ABHD12 antibody (Abhydrolase Domain Containing 12) (Middle Region)

Details for Product anti-ABHD12 Antibody No. ABIN635357
Antigen
Epitope
Middle Region
11
9
9
4
3
3
1
1
1
Reactivity
Human
54
26
25
4
4
4
4
3
2
1
1
1
1
Host
Rabbit
45
7
3
Clonality
Polyclonal
Conjugate
This ABHD12 antibody is un-conjugated
4
3
3
3
3
3
1
1
1
1
1
1
Application
Western Blotting (WB)
46
37
12
6
6
1
1
Options
Immunogen ABHD12 antibody was raised using the middle region of ABHD12 corresponding to a region with amino acids CPLLILHAEDDPVVPFQLGRKLYSIAAPARSFRDFKVQFVPFHSDLGYRH
Specificity ABHD12 antibody was raised against the middle region of ABHD12
Purification Affinity purified
Antigen
Alternative Name ABHD12 (ABHD12 Antibody Abstract)
Background ABHD12 may be a regulator of endocannabinoid signaling pathways.
Molecular Weight 45 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

ABHD12 Blocking Peptide, catalog no. 33R-1766, is also available for use as a blocking control in assays to test for specificity of this ABHD12 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABHD12 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Abhydrolase Domain Containing 12 (ABHD12) (Middle Region) antibody (ABIN635357) ABHD12 antibody used at 1 ug/ml to detect target protein.