Integrin alpha-8 / ITGA8 (N-Term) antibody

Details for Product No. ABIN635422
Antigen
Epitope
N-Term
12
10
8
4
3
2
2
1
1
1
1
Reactivity
Human
44
11
6
2
2
2
1
1
1
1
1
Host
Rabbit
36
8
4
Clonality
Polyclonal
Conjugate
Un-conjugated
5
4
4
2
2
2
1
1
1
1
1
1
Application
Western Blotting (WB)
38
22
19
9
4
3
2
1
Options
Immunogen Integrin Alpha 8 antibody was raised using the N terminal of ITGA8 corresponding to a region with amino acids GEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSI
Specificity Integrin Alpha 8 antibody was raised against the N terminal of ITGA8
Purification Affinity purified
Antigen
Alternative Name Integrin alpha 8
Background Integrin alpha-8/beta-1 functions in the genesis of kidney and probably of other organs by regulating the recruitment of mesenchymal cells into epithelial structures.
Molecular Weight 117 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

Integrin Alpha 8 Blocking Peptide, catalog no. 33R-3233, is also available for use as a blocking control in assays to test for specificity of this Integrin Alpha 8 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGA8 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Integrin alpha-8 / ITGA8 (N-Term) antibody (ABIN635422) Integrin Alpha 8 antibody used at 1 ug/ml to detect target protein.