ITGA8 antibody (N-Term)

Catalog No. ABIN635422

Product Details anti-ITGA8 Antibody

Target: ITGA8 (Integrin alpha-8 (ITGA8))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ITGA8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Integrin Alpha 8 antibody was raised against the N terminal of ITGA8

Purification: Affinity purified

Immunogen: Integrin Alpha 8 antibody was raised using the N terminal of ITGA8 corresponding to a region with amino acids GEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Integrin Alpha 8 Blocking Peptide, catalog no. 33R-3233, is also available for use as a blocking control in assays to test for specificity of this Integrin Alpha 8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGA8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ITGA8

Target: ITGA8 (Integrin alpha-8 (ITGA8))

Alternative Name: Integrin alpha 8 (ITGA8 Products)

Synonyms: AI447669 antibody, RGD1564327 antibody, integrin alpha 8 antibody, integrin subunit alpha 8 antibody, Itga8 antibody, ITGA8 antibody

Background: Integrin alpha-8/beta-1 functions in the genesis of kidney and probably of other organs by regulating the recruitment of mesenchymal cells into epithelial structures.

Molecular Weight: 117 kDa (MW of target protein)