RER1 antibody (RER1 Retention in Endoplasmic Reticulum 1 Homolog (S. Cerevisiae))

Details for Product anti-RER1 Antibody No. ABIN635434
Antigen
Reactivity
Human, Mouse (Murine), Rat (Rattus)
14
3
3
2
2
2
2
2
2
1
1
1
1
Host
Rabbit
7
7
Clonality
Polyclonal
Conjugate
This RER1 antibody is un-conjugated
2
2
2
1
1
1
Application
Western Blotting (WB)
12
3
3
1
Options
Immunogen RER1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKF
Purification Affinity purified
Antigen
Alternative Name RER1 (RER1 Antibody Abstract)
Background RER1 is involved in the retrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment.
Molecular Weight 23 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

RER1 Blocking Peptide, catalog no. 33R-3349, is also available for use as a blocking control in assays to test for specificity of this RER1 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RER1 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-RER1 Retention in Endoplasmic Reticulum 1 Homolog (S. Cerevisiae) (RER1) antibody (ABIN635434) RER1 antibody used at 1 ug/ml to detect target protein.