SLC24A6 antibody (Middle Region)

Catalog No. ABIN635875

Product Details anti-SLC24A6 Antibody

Target: SLC24A6 (Solute Carrier Family 24 (Sodium/potassium/calcium Exchanger), Member 6 (SLC24A6))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC24A6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLC24 A6 antibody was raised against the middle region of SLC24 6

Purification: Affinity purified

Immunogen: SLC24 A6 antibody was raised using the middle region of SLC24 6 corresponding to a region with amino acids SIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC24A6 Blocking Peptide, catalog no. 33R-8526, is also available for use as a blocking control in assays to test for specificity of this SLC24A6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC24A6

Target: SLC24A6 (Solute Carrier Family 24 (Sodium/potassium/calcium Exchanger), Member 6 (SLC24A6))

Alternative Name: SLC24A6 (SLC24A6 Products)

Background: SLC24A6 belongs to a family of potassium-dependent sodium/calcium exchangers that maintain cellular calcium homeostasis through the electrogenic countertransport of 4 sodium ions for 1 calcium ion and 1 potassium ion.

Molecular Weight: 64 kDa (MW of target protein)

Pathways: Carbohydrate Homeostasis