CLCN3 antibody (C-Term, Intracellular)

Catalog No. ABIN7043052

Product Details anti-CLCN3 Antibody

Target: CLCN3 (Chloride Channel 3 (CLCN3))

Binding Specificity: AA 592-661, C-Term, Intracellular

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CLCN3 antibody is un-conjugated

Application: Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blotting (WB)

Characteristics: Anti-CLC-3 (CLCN3) Antibody (ABIN7043052, ABIN7044121 and ABIN7044122)) is a highly specific antibody directed against an epitope of the rat protein. The antibody can be used in western blot and immunohistochemistry applications. It has been designed to recognize CLC-3 from rat, mouse, and human samples.

Purification: The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

Immunogen:

Immunogen: GST fusion protein

Immunogen Sequence: GST fusion protein with the sequence SLVVIVFELTGGLEYIVPLMAAVMTSKWVGDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRPR, corresponding to amino acid residues 592-661 of rat CLC-3

Isotype: IgG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: 25 μL, 50 μL or 0.2 mL double distilled water (DDW), depending on the sample size.

Concentration: 0.8 mg/mL

Buffer: Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1 % BSA, 5 % sucrose, 0.025 % Sodium azide.

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: RT,4 °C,-20 °C

Storage Comment:

Storage before reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.

Storage after reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Target Details for CLCN3

Target: CLCN3 (Chloride Channel 3 (CLCN3))

Alternative Name: CLC-3 (CLCN3) (CLCN3 Products)

Synonyms: CLC3 antibody, ClC-3 antibody, Clc3 antibody, CLCN3 antibody, fb78c02 antibody, wu:fb78c02 antibody, clc3 antibody, clc-3 antibody, chloride voltage-gated channel 3 antibody, chloride channel, voltage-sensitive 3 antibody, chloride channel 3 antibody, chloride channel protein 3 antibody, chloride channel, voltage-sensitive 3 S homeolog antibody, CLCN3 antibody, Clcn3 antibody, clcn3 antibody, PTRG_03131 antibody, BDBG_05668 antibody, MCYG_04420 antibody, clcn3.S antibody

Background: Alternative names: CLC-3 (CLCN3), Chloride channel 3, Chloride transporter ClC-3, H+/Cl- exchange transporter 3

Gene ID: 84360

NCBI Accession: NM_001243372

UniProt: P51792