CLCN3 antibody (C-Term, Intracellular)
-
- Target See all CLCN3 Antibodies
- CLCN3 (Chloride Channel 3 (CLCN3))
-
Binding Specificity
- AA 592-661, C-Term, Intracellular
-
Reactivity
- Rat, Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CLCN3 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunofluorescence (IF), Immunoprecipitation (IP)
- Characteristics
- Anti-CLC-3 (CLCN3) Antibody (ABIN7043052, ABIN7044121 and ABIN7044122)) is a highly specific antibody directed against an epitope of the rat protein. The antibody can be used in western blot and immunohistochemistry applications. It has been designed to recognize CLC-3 from rat, mouse, and human samples.
- Purification
- The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
- Immunogen
-
Immunogen: GST fusion protein
Immunogen Sequence: GST fusion protein with the sequence SLVVIVFELTGGLEYIVPLMAAVMTSKWVGDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRPR, corresponding to amino acid residues 592-661 of rat CLC-3
- Isotype
- IgG
- Top Product
- Discover our top product CLCN3 Primary Antibody
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- 25 μL, 50 μL or 0.2 mL double distilled water (DDW), depending on the sample size.
- Concentration
- 0.8 mg/mL
- Buffer
- Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1 % BSA, 5 % sucrose, 0.025 % Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- RT,4 °C,-20 °C
- Storage Comment
-
Storage before reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.
Storage after reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
-
- Target
- CLCN3 (Chloride Channel 3 (CLCN3))
- Alternative Name
- CLC-3 (CLCN3) (CLCN3 Products)
- Synonyms
- CLC3 antibody, ClC-3 antibody, Clc3 antibody, CLCN3 antibody, fb78c02 antibody, wu:fb78c02 antibody, clc3 antibody, clc-3 antibody, chloride voltage-gated channel 3 antibody, chloride channel, voltage-sensitive 3 antibody, chloride channel 3 antibody, chloride channel protein 3 antibody, chloride channel, voltage-sensitive 3 S homeolog antibody, CLCN3 antibody, Clcn3 antibody, clcn3 antibody, PTRG_03131 antibody, BDBG_05668 antibody, MCYG_04420 antibody, clcn3.S antibody
- Background
- Alternative names: CLC-3 (CLCN3), Chloride channel 3, Chloride transporter ClC-3, H+/Cl- exchange transporter 3
- Gene ID
- 84360
- NCBI Accession
- NM_001243372
- UniProt
- P51792
-