Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

CLCN3 antibody (C-Term, Intracellular)

CLCN3 Reactivity: Human, Rat ICC, IF, IHC, IP, WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN7043052
$703.08
Plus shipping costs $45.00
Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target See all CLCN3 Antibodies
    CLCN3 (Chloride Channel 3 (CLCN3))
    Binding Specificity
    • 15
    • 13
    • 8
    • 7
    • 7
    • 7
    • 5
    • 3
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 592-661, C-Term, Intracellular
    Reactivity
    • 45
    • 33
    • 31
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Human, Rat
    Host
    • 48
    • 15
    • 1
    Rabbit
    Clonality
    • 49
    • 15
    Polyclonal
    Conjugate
    • 21
    • 5
    • 4
    • 4
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This CLCN3 antibody is un-conjugated
    Application
    • 44
    • 20
    • 20
    • 13
    • 13
    • 12
    • 11
    • 4
    • 3
    • 1
    • 1
    Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blotting (WB)
    Characteristics
    Anti-CLC-3 (CLCN3) Antibody (ABIN7043052, ABIN7044121 and ABIN7044122)) is a highly specific antibody directed against an epitope of the rat protein. The antibody can be used in western blot and immunohistochemistry applications. It has been designed to recognize CLC-3 from rat, mouse, and human samples.
    Purification
    The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
    Immunogen

    Immunogen: GST fusion protein

    Immunogen Sequence: GST fusion protein with the sequence SLVVIVFELTGGLEYIVPLMAAVMTSKWVGDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRPR, corresponding to amino acid residues 592-661 of rat CLC-3

    Isotype
    IgG
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    25 μL, 50 μL or 0.2 mL double distilled water (DDW), depending on the sample size.
    Concentration
    0.8 mg/mL
    Buffer
    Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1 % BSA, 5 % sucrose, 0.025 % Sodium azide.
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Storage
    RT,4 °C,-20 °C
    Storage Comment

    Storage before reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.

    Storage after reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

  • Target
    CLCN3 (Chloride Channel 3 (CLCN3))
    Alternative Name
    CLC-3 (CLCN3) (CLCN3 Products)
    Synonyms
    CLC3 antibody, ClC-3 antibody, Clc3 antibody, CLCN3 antibody, fb78c02 antibody, wu:fb78c02 antibody, clc3 antibody, clc-3 antibody, chloride voltage-gated channel 3 antibody, chloride channel, voltage-sensitive 3 antibody, chloride channel 3 antibody, chloride channel protein 3 antibody, chloride channel, voltage-sensitive 3 S homeolog antibody, CLCN3 antibody, Clcn3 antibody, clcn3 antibody, PTRG_03131 antibody, BDBG_05668 antibody, MCYG_04420 antibody, clcn3.S antibody
    Background
    Alternative names: CLC-3 (CLCN3), Chloride channel 3, Chloride transporter ClC-3, H+/Cl- exchange transporter 3
    Gene ID
    84360
    NCBI Accession
    NM_001243372
    UniProt
    P51792
You are here: