anti-Rat (Rattus) YWHAZ antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended YWHAZ Antibody

tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) Antibodies
  • 14-3-3-zeta
  • KCIP-1
  • 14-3-3zeta
  • Ywhaz
  • ACYPI003154
  • 14-3-3z
  • kcip-1
  • ywhaq
  • 1433z
  • ywhaz
  • ywhazb
  • 1110013I11Rik
  • AI596267
  • AL022924
  • AU020854
  • ywhaza
  • fb14h09
  • wu:fb05g08
  • wu:fb14h09
  • ywhai
  • zgc:55807
  • 14-3-3
  • 14-3-3 zeta
  • 14-3-3ZETA
  • 14-3-3leo
  • 2G1
  • 4-3-3 zeta
  • 5.11
  • 549
  • BEST:GH05075
  • CG17870
  • D14-3-3
  • D14-3-3zeta
  • Dmel\\CG17870
  • K
  • LEO
  • Leo
  • PAR-5
  • PAR5
  • Par-5
  • d14-3-3zeta
  • l(2)07103
  • l(2)46CFe
  • l(2)46Ee
  • leo
  • par-5
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta
  • 14-3-3 protein zeta
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta L homeolog
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta S homeolog
  • 14-3-3 protein zeta/delta pseudogene
  • CG17870 gene product from transcript CG17870-RE
  • 14-3-3zeta
  • ywhaz
  • 1433z
  • ywhaz.L
  • Ywhaz
  • ywhaz.S
  • LOC100855903
Human, Mouse (Murine), Rat (Rattus)
This YWHAZ antibody is un-conjugated
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)

Available images

Catalog No. ABIN5708416
$ 452.38
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Clonality References Details
11.86067 ABIN213857 IHC IHC (p) WB Rabbit Internal Region Polyclonal 0
11.86067 ABIN498366 IHC (p) WB Rabbit Polyclonal 0
11.86067 ABIN498090 IF IHC (p) IP WB Rabbit Polyclonal 0
11.5 ABIN272122 IF IHC (p) WB Rabbit Polyclonal 2
10 ABIN6652239 IF IHC (p) WB Rabbit pSer58 Polyclonal 3
10 ABIN1491173 IHC IHC (p) WB Rabbit AA 200-245 Polyclonal 0
8.86067 ABIN682693 IF (p) IHC (p) WB Rabbit IgG pSer58 Polyclonal 0
7 ABIN6747116 IHC IHC (p) WB Rabbit C-Term Polyclonal 0
4 ABIN2879095 ELISA IHC IHC (p) WB Rabbit IgG AA 51-100 Polyclonal 0
4 ABIN2879023 ELISA IF IHC IHC (p) WB Rabbit IgG AA 196-245 Polyclonal 0
4 ABIN372184 IHC (p) WB Rabbit IgG Internal Region Polyclonal 0
4 ABIN5960362 ELISA IF IHC (p) WB Rabbit IgG pSer58 Polyclonal 0
4 ABIN5960360 ELISA IF IHC (p) IP WB Rabbit IgG Ser58 Polyclonal 0
1 ABIN609110 ELISA IHC IHC (p) WB Rabbit IgG AA 1-10 Polyclonal 0
1 ABIN1731318 IHC (p) WB Rabbit IgG Internal Region Polyclonal 0
1 ABIN1731317 IHC (p) WB Rabbit IgG AA 200-245 Polyclonal 0
1 ABIN682702 IHC (p) WB HRP Rabbit IgG pSer58 Polyclonal 0
1 ABIN2892294 IHC IHC (p) WB Rabbit Ala79 Polyclonal 0
1 ABIN2893823 IHC IHC (p) WB Rabbit pSer58 Polyclonal 0
1 ABIN2891297 IF IHC IHC (p) IP WB Rabbit Val52 Polyclonal 0


Antigen tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(246), (174), (143), (24), (23), (19), (19), (11), (7), (7), (6), (6), (4), (3), (2), (2), (1), (1)
Host Rabbit
(239), (9)
Conjugate This YWHAZ antibody is un-conjugated
(10), (5), (5), (4), (4), (4), (4), (4), (4), (3), (3), (3), (1), (1), (1), (1), (1)
Application Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(206), (125), (88), (60), (51), (24), (14), (13), (12), (6), (3), (2)

Product Details anti-YWHAZ Antibody

Target Details YWHAZ Application Details Handling Images
Purification Antigen affinity purified
Immunogen Amino acids LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ were used as the immunogen for the 14-3-3 zeta antibody.
Isotype IgG
Plasmids, Primers & others

Target Details YWHAZ

Product Details anti-YWHAZ Antibody Application Details Handling Images back to top
Alternative Name 14-3-3 zeta / YWHAZ (YWHAZ Antibody Abstract)
Background 14-3-3 protein zeta/delta is a protein that in humans is encoded by the YWHAZ gene on chromosome 8. This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99 % identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene.
UniProt P63104
Pathways Apoptosis, Hormone Transport, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Membrane, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location

Application Details

Product Details anti-YWHAZ Antibody Target Details YWHAZ Handling Images back to top
Application Notes Optimal dilution of the 14-3-3 zeta antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL, IHC (FFPE): 1-2 μg/mL
Restrictions For Research Use only


Product Details anti-YWHAZ Antibody Target Details YWHAZ Application Details Images back to top
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Storage -20 °C
Storage Comment After reconstitution, the 14-3-3 zeta antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.


Product Details anti-YWHAZ Antibody Target Details YWHAZ Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) antibody (ABIN5708416) Western blot testing of human 1) HeLa, 2) placenta, 3) HepG2, 4) A549, 5) PANC-1, 6) ...
Immunohistochemistry (IHC) image for anti-tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) antibody (ABIN5708416) IHC testing of FFPE human lung cancer tissue with 14-3-3 zeta antibody at 1ug/ml. Req...
Immunohistochemistry (IHC) image for anti-tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) antibody (ABIN5708416) IHC testing of FFPE human breast cancer tissue with 14-3-3 zeta antibody at 1ug/ml. R...
Immunohistochemistry (IHC) image for anti-tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) antibody (ABIN5708416) IHC testing of FFPE rat kidney tissue with 14-3-3 zeta antibody at 1ug/ml. Required H...
Immunohistochemistry (IHC) image for anti-tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) antibody (ABIN5708416) IHC testing of FFPE rat small intestine tissue with 14-3-3 zeta antibody at 1ug/ml. R...