Add to Basket
Order hotline:
 |
+1 404 474 4654 |
 |
+1 888 205 9894 (TF) |
Defensin, beta 4A (DEFB4) (AA 4-41) antibody
| Antigen | Defensin, beta 4A (DEFB4) |
| Synonyms |
SAP1, DEFB2, HBD-2, DEFB-2, DEFB102, MGC129140, MGC129141, MBD-4, 2310001F05Rik, Defb2, Defb3, BD-4, DEFB4, hBD-4, DEFB-4, DEFB104, MGC118942, MGC118944, MGC118945, GAL2, PBD-2, GAL4, BD2, DEFB4P, DEF ...
show more
|
| Epitope |
 Alternatives AA 4-41 |
| Clonality | Monoclonal (L12-4C-C2) |
| Host |
Alternatives Mouse |
| Reactivity |
Alternatives Human |
| Application |
Alternatives ELISA
|
| Catalog no. | ABIN109996 |
| Quantity | 100 µg (Variants) |
| Price | 611.00 $ Plus shipping costs $35.00 |
| Shipping to |
|
| Availability | Ships within 3 to 5 Business Days |
Additional Information
| Alternative name | beta-Defensin 2 (aa 4-41) |
| Immunogen | Synthetic human 61538-Defensin 2 (aa 4-41) (DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP) |
| Isotype | IgG1 (Matching secondary antibodies) |
| Clone | L12-4C-C2 |
| Description | Cell culture supernatant, protein G purified, 50 mM TRIS pH 7,4 |
| Specificity | Synthetic human 61538-Defensin 2 (aa 4-41) |
| Synonyms | SAP1, DEFB2, HBD-2, DEFB-2, DEFB102, MGC129140, MGC129141, MBD-4, 2310001F05Rik, Defb2, Defb3, BD-4, DEFB4, hBD-4, DEFB-4, DEFB104, MGC118942, MGC118944, MGC118945, GAL2, PBD-2, GAL4, BD2, DEFB4P, DEFB104A, THP2, DEFB104B, BD-2 |
Application Details
| Application Notes | ELISA This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls. |
| Storage | 2-8 Degrees Celsius (lyophilized) - 20 Degrees Celsius (dissolved) Repeated thawing and freezing must be avoided |
| Research Area | Immunology |
| Restrictions | For Research Use only |
Alternatives
Alternatives for antigen "Defensin, beta 4A (DEFB4)", type "Antibodies"
| Hosts | Rabbit (24), Mouse (9), Sheep (8), Goat (6) |
| Reactivities | Human (31), Rat (Rattus) (20), Mouse (Murine) (5), Cow (Bovine) (1) |
| Applications | Western Blotting (WB) (20), Flow Cytometry (FACS) (18), Immunofluorescence (IF) (18), ELISA (16), Enzyme Immunoassay (EIA) (12), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (6), Immunohistochemistry (IHC) (4), Radioimmunoassay (RIA) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunohistochemistry (Frozen Sections) (IHC (fro)) (2), Immunoprecipitation (IP) (2), Dot Blot (Dot) (1), Immunoelectron Microscopy (IEM) (1) |
| Conjugates | Biotin (4), Alexa Flour 488 (1), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1), RBITC (1) |
| Epitopes | AA 4-41 (12), AA 3-39 (4) |
