Did you know that you can buy products from over 140 different suppliers from us?

Ring Finger Protein 138 (RNF138) (C-Term) antibody

Details for Product No. ABIN1108890
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HSD-4, NARF, STRIN, hNARF, 2410015A17Rik, 2810480D20Rik, Trif, Trif-d, Rsd4, narf
Epitope
C-Term
(8), (7), (2), (2), (2), (1), (1), (1)
Reactivity
Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
(35), (20), (20), (13), (12), (12)
Host
Rabbit
(35), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(24), (18), (10), (4), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Shipping to United States (Change)
Availability Will be delivered in 6 to 8 Business Days
Catalog No. ABIN1108890
401.50 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen The immunogen for anti-RNF138 antibody: synthetic peptide directed towards the C terminal of human RNF138.
Sequence LFQIVPVTCPICVSLPWGDPSQITRNFVSHLNQRHQFDYGEFVNLQLDEE
Purification Purified using peptide immunoaffinity column
Alternative Name RNF138
Background RNF138 contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-DNA and protein-protein interactions.The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-DNA and protein-protein interactions. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
Alternate names: E3 ubiquitin-protein ligase RNF138, HSD-4, HSD4, NARF, NLK-associated RING finger protein, Nemo-like kinase-associated RING finger protein, RING finger protein 138
Gene ID 51444
NCBI Accession NP_057355
Research Area Chromatin and Nuclear Signaling, Cell Cycle, Proteolysis / Ubiquitin, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water to a final concentration of 1 mg/mL.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
Expiry Date 12 months
Background publications Yamada, Ohnishi, Ohkawara et al.: "NARF, an nemo-like kinase (NLK)-associated ring finger protein regulates the ubiquitylation and degradation of T cell factor/lymphoid enhancer factor (TCF/LEF)." in: The Journal of biological chemistry, Vol. 281, Issue 30, pp. 20749-60, 2006 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN1108890
401.50 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top