IKAROS Family Zinc Finger 5 (Pegasus) (IKZF5) (N-Term) antibody

Details for Product No. ABIN1109610
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms pegasus, znfn1a5, ZNFN1A5, 2610034F18Rik, PEGASUS, Zfpn1a5
Epitope
N-Term
(2), (1), (1)
Reactivity
Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Xenopus laevis
(5), (1), (1), (1), (1), (1), (1), (1)
Host
Rabbit
(4), (2)
Clonality
Polyclonal
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(5), (3), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN1109610
Quantity 50 µg
Price
401.50 $   Plus shipping costs $45.00
Shipping to United States (Change)
Availability Will be delivered in 6 to 8 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen The immunogen for anti-ZNFN1A5 antibody: synthetic peptide directed towards the N terminal of human ZNFN1A5
Sequence MGEKKPEPLDFVKDFQEYLTQQTHHVNMISGSVSGDKEAEALQGAGTDGD
Purification Purified using peptide immunoaffinity column
Alternative Name ZNFN1A5 / IKZF5 / Pegasus
Background IKZF5 also called ZNFN1A5 or Pegasus is a DNA-binding protein that binds to the 5'GNNTGTNG-3' core sequence and acts as transcriptional repressor. Interacts with other family members, IKZF1, IKZF2, IKZF3 AND IKZF4. Expressed in brain, heart, skeletal muscle, kidney, and liver. Expressed in the hematopoietic cell lines MOLT-4, NALM-6 and K-562. Highly expressed in THP-1 and M-07e cell lines, which have characteristics of myeloid and early megakaryocytic cells respectively.
Alternate names: Ikaros family zinc finger protein 5, Zinc finger protein Pegasus
Gene ID 64376
NCBI Accession NP_071911
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water to a final concentration of 1 mg/mL.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
Expiry Date 12 months
Background publications Perdomo, Holmes, Chong et al.: "Eos and pegasus, two members of the Ikaros family of proteins with distinct DNA binding activities." in: The Journal of biological chemistry, Vol. 275, Issue 49, pp. 38347-54, 2001 (PubMed).

Hosts (4), (2)
Reactivities (5), (1), (1), (1), (1), (1), (1), (1)
Applications (5), (3), (1), (1), (1)
Epitopes (2), (1), (1)
back to top