Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN1109615

Zinc Finger and SCAN Domain Containing 20 (ZSCAN20) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms KOX29, ZNF31, ZFP-31, ZNF360, C130001F22, Zfp31, Zkscan20, RGD1562996, ZSCAN20
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human, Mouse (Murine), Rat (Rattus)
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN1109615
Quantity 50 µg
Price
390.50 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 6 to 8 Business Days
Immunogen The immunogen for anti-ZSCAN20 antibody: synthetic peptide directed towards the middle region of human ZSCAN20
Sequence QESSSEEDLEKLIDHQGLYLAEKPYKCDTCMKSFSRSSHFIAHQRIHTGE
Purification Purified using peptide immunoaffinity column
Alternative Name ZSCAN20
Background ZSCAN20 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 10 C2H2-type zinc fingers and 1 SCAN box domain. ZSCAN20 may be involved in transcriptional regulation.
Alternate names: KOX29, ZFP31, ZNF31, ZNF360, Zinc finger and SCAN domain-containing protein 20, Zinc finger protein 31, Zinc finger protein 360, Zinc finger protein KOX29
Gene ID 7579
NCBI Accession NP_660281
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water to a final concentration of 1 mg/mL.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
Expiry Date 12 months
Background publications Jordanova, Irobi, Thomas et al.: "Disrupted function and axonal distribution of mutant tyrosyl-tRNA synthetase in dominant intermediate Charcot-Marie-Tooth neuropathy." in: Nature genetics, Vol. 38, Issue 2, pp. 197-202, 2006 (PubMed).

Alternatives for antigen "Zinc Finger and SCAN Domain Containing 20 (ZSCAN20)", type "Antibodies"
Hosts (7), (7)
Reactivities (14), (2), (1), (1)
Applications (14), (6), (3)
Epitopes (6), (2), (2), (1), (1)
Beacon