Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN1449822

Annexin A8-Like 2 (ANXA8L2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ANXA8, bA145E20.2, ANXA8L1, ANXA8L2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rabbit, Rat (Rattus), Xenopus laevis
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN1449822
Quantity 50 µg
Price
390.50 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 6 to 8 Business Days
Immunogen Synthetic peptide directed towards the N terminal of human ANXA8L2
Sequence PDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTET
Purification Purified using peptide immunoaffinity column
Alternative Name ANXA8L2
Background ANXA8L2 is a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. ANXA8L2 may function as an an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of ANXA8L2 has been associated with acute myelocytic leukemia.This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.
Alternate names: Annexin A8-like protein 2
Gene ID 244
NCBI Accession NP_001621
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water to a final concentration of 1 mg/mL.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment Store lyophilized at 2-8°C for one month or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
Expiry Date 12 months
Background publications Karanjawala, Illei, Ashfaq et al.: "New markers of pancreatic cancer identified through differential gene expression analyses: claudin 18 and annexin A8." in: The American journal of surgical pathology, Vol. 32, Issue 2, pp. 188-96, 2008 (PubMed).

Alternatives for antigen "Annexin A8-Like 2 (ANXA8L2)", type "Antibodies"
Hosts (13)
Reactivities (10), (4), (4), (2), (2), (2), (2), (1), (1)
Applications (11), (4), (1), (1), (1)
Epitopes (2), (1), (1), (1), (1)
Beacon