Arylsulfatase E (ARSE) (Middle Region) antibody

Details for Product No. ABIN1449829
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ASE, CDPX, CDPX1, CDPXR, ARSE, MGC155058
Epitope
Middle Region
(4), (1), (1), (1), (1), (1)
Reactivity
Human
(12)
Host
Rabbit
(11), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(11), (6), (1)
Pubmed 1 reference available
Quantity 50 µg
Shipping to United States (Change)
Availability Will be delivered in 6 to 8 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN1449829
401.50 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ARSE
Sequence KVVHHDPPLLFDLSRDPSETHILTPASEPVFYQVMERVQQAVWEHQRTLS
Purification Purified using peptide immunoaffinity column
Alternative Name Arylsulfatase E
Background Arylsulfatase E is a member of the sulfatase family. It is glycosylated postranslationally and localized to the golgi apparatus. Sulfatases are essential for the correct composition of bone and cartilage matrix. X-linked chondrodysplasia punctata, a disease characterized by abnormalities in cartilage and bone development, has been linked to mutations in this gene.Arylsulfatase E is a member of the sulfatase family. It is glycosylated postranslationally and localized to the golgi apparatus. Sulfatases are essential for the correct composition of bone and cartilage matrix. X-linked chondrodysplasia punctata, a disease characterized by abnormalities in cartilage and bone development, has been linked to mutations in this gene.
Alternate names: ARSE, ASE
Gene ID 415
NCBI Accession NP_000038
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water to a final concentration of 1 mg/mL.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment Store lyophilized at 2-8°C for one month or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
Expiry Date 12 months
Background publications Nino, Matos-Miranda, Maeda et al.: "Clinical and molecular analysis of arylsulfatase E in patients with brachytelephalangic chondrodysplasia punctata." in: American journal of medical genetics. Part A, Vol. 146A, Issue 8, pp. 997-1008, 2008 (PubMed).

Validation Images
back to top