Zinc Finger Protein 341 (ZNF341) antibody

Antigen: Zinc Finger Protein 341 (ZNF341)

Synonyms: Znf341, MGC73471, ZNF341, ZFP341, MGC152591

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Dog (Canine)

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN182313

Additional Information

Alternative name: ZNF341

Gene ID: ZNF341

Immunogen: The immunogen for anti-ZNF341 antibody: synthetic peptide directed towards the middle region of human ZNF341

Sequence: GEEEGDKPESKQVVLIDSSYLCQFCPSKFSTYFQLKSHMT QHKNEQVYKC

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF341 antibody concentration is 1 mg/ml.

Description: The ZNF341 gene is located on chromosome 20.

Characteristics: Antigen Size: 847 amino acids

Molecular Weight: 92kDa

Application Details

Application Notes: WB Suggested Anti-ZNF341 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF341 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

anti-Zinc Finger Protein 341 (ZNF341) antibody (Image 2)

Publications

Product: Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).