Zinc Finger and BTB Domain Containing 45 (ZBTB45) antibody

Antigen: Zinc Finger and BTB Domain Containing 45 (ZBTB45)

Synonyms: ZNF499, FLJ14486, DKFZp547H249

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN182315

Additional Information

Alternative name: ZBTB45

Gene ID: ZNF499

UniProt: Q96K62

Immunogen: The immunogen for anti-ZNF499 antibody: synthetic peptide directed towards the middle region of human ZNF499

Sequence: CEEPPAPTGLADYSGAGRDFLRGAGSAEDVFPDSYVSTWH DEDGAVPEGC

Cross-Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF499 antibody concentration is 1 mg/ml.

Description: The ZNF499 gene is located on chromosome 19 and encodes a protein with unknown function.

Characteristics: Antigen Size: 511 amino acids

Molecular Weight: 54kDa

Application Details

Application Notes: WB Suggested Anti-ZNF499 Antibody Titration: 0.015ug/ml
ELISA Titer: 1:312500
Positive Control: Human Lung.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF499 Antibody Titration: 0.015ug/ml
ELISA Titer: 1:312500
Positive Control: Human Lung

Publications

Product: Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).