Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

GLIS Family Zinc Finger 2 (GLIS2) antibody

Antigen

GLIS Family Zinc Finger 2 (GLIS2)

Synonyms NPHP7, FLJ38247, glis2b, nkl-A, xNKLb, GLIS2, glis2a, NKL, glis2, MGC82119
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Dog (Canine), Human, Rat (Rattus), Mouse (Murine)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN182317
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name GLIS2
Gene ID GLIS2
UniProt Q9BZE0
Immunogen The immunogen for anti-GLIS2 antibody: synthetic peptide directed towards the N terminal of human GLIS2
Sequence LSPPSGLDSPNGSSSLSPERQGNGDLPPVPSASDFQPLRY LDGVPSSFQF
Cross-Reactivity Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-GLIS2 antibody concentration is 1 mg/ml.
Description Members of the Kruppel-like zinc finger protein family, such as GLIS2, function as activators and/or repressors of gene transcription.[supplied by OMIM].
Characteristics Antigen Size: 524 amino acids
Molecular Weight 56kDa

Application Details

Application Notes WB Suggested Anti-GLIS2 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Kim, Nakanishi, Lewandoski et al.: "GLIS3, a novel member of the GLIS subfamily of Krüppel-like zinc finger proteins with repressor and activation functions." in: Nucleic acids research, Vol. 31, Issue 19, pp. 5513-25, 2003 (PubMed).

Alternatives

Alternatives for antigen "GLIS Family Zinc Finger 2 (GLIS2)", type "Antibodies"
Hosts Rabbit (22)
Reactivities Human (22), Chicken (19), Cow (Bovine) (19), Dog (Canine) (19), Mouse (Murine) (19), Rat (Rattus) (19), Pig (Porcine) (18), Rabbit (18), Sheep (Ovine) (18), Xenopus laevis (1)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (7), ELISA (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes N-Term (2)