Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182323

Zinc Finger Protein 512 (ZNF512) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RGD1561526, Znf512, 2500002M11Rik, AI450173, D230008H22, ZNF512, DKFZp459C096, DKFZp459N067, DKFZp469L1621
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182323
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF512 antibody: synthetic peptide directed towards the middle region of human ZNF512
Sequence QLRSLAGMKYHVMANHNSLPILKAGDEIDEPSERERLRTV LKRLGKLRCM
Predicted Reactivity Guinea pig : 100%, Horse : 100%, Human : 100%, Pig : 100%, Rabbit : 92%
Characteristics This is a rabbit polyclonal antibody against ZNF512. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF512
Background ZNF512 is a new candidate transcription factor.
Molecular Weight 65kDa
Gene ID 84450
NCBI Accession NP_115810, NM_032434
UniProt Q96ME7
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF512 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Zinc Finger Protein 512 (ZNF512)", type "Antibodies"
Hosts (8)
Reactivities (8), (1), (1), (1)
Applications (8), (2)
Epitopes (3), (2), (1), (1), (1), (1)
Beacon