Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 512 (ZNF512) (Middle Region) antibody

Details for Product No. ABIN182323
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF512, 2500002M11Rik, AI450173, D230008H22, Znf512, RGD1561526
Epitope
Middle Region
(7), (6), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(13), (1), (1), (1)
Host
Rabbit
(13)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(13), (9)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182323
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZNF512
Sequence QLRSLAGMKYHVMANHNSLPILKAGDEIDEPSERERLRTV LKRLGKLRCM
Predicted Reactivity Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 90 %
Characteristics This is a rabbit polyclonal antibody against ZNF512. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF512
Background ZNF512 is a new candidate transcription factor.
Molecular Weight 65 kDa
Gene ID 84450
NCBI Accession NM_032434, NP_115810
UniProt Q96ME7
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 567 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Validation Images
back to top