TSC22 Domain Family, Member 4 (TSC22D4) antibody
| Antigen | TSC22 Domain Family, Member 4 (TSC22D4) |
| Synonyms | Tilz2, AI415410, Thg-1pit, 0610009M14Rik, 1700023B23Rik, THG1, THG-1, TSC22D4, MGC152079, MGC125073 |
| Clonality | Polyclonal |
| Host |
 Alternatives Rabbit |
| Reactivity |
Alternatives Human, Pig (Porcine) |
| Application |
Alternatives Western Blotting (WB), Immunohistochemistry (IHC) |
 |
1 reference available |
| Catalog no. | ABIN182336 |
| Quantity | 0.1 mg (Variants) |
| Price | 251.90 $ Plus shipping costs $45.00 |
| Shipping to |
|
| Availability | Will be delivered in 2 to 3 Business Days |
Additional Information
| Alternative name | TSC22D4 |
| Gene ID | TSC22D4 |
| UniProt | Q9Y3Q8 |
| Immunogen | The immunogen for anti-TSC22D4 antibody: synthetic peptide directed towards the N terminal of human TSC22D4 |
| Sequence | SGGKKKSSFQITSVTTDYEGPGSPGASDPPTPQPPTGPPP RLPNGEPSPD |
| Cross-Reactivity | Human, Pig (Porcine) |
| Format | Lyophilized |
| Reconstitution | Add 100 µl of distilled water. Final anti-TSC22D4 antibody concentration is 1 mg/ml. |
| Description | TSC22D4 is a leucine zipper-containing protein that is highly conserved during evolution. It is transcriptionally up-regulated by many different stimuli, including anti-cancer drugs and growth inhibitors. TSC22D4 may play a suppressive role in tumorigenesis. |
| Characteristics | Antigen Size: 395 amino acids |
| Molecular Weight | 41kDa |
Application Details
| Application Notes |
WB Suggested Anti-TSC22D4 Antibody Titration: 0.5ug/ml ELISA Titer: 1:62500 Positive Control: HepG2 cell lysate. |
| Purification | Protein A purified |
| Buffer | PBS |
| Storage (Long Term) | For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Storage (Short Term) | Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. |
| Restrictions | For Research Use only |
Images
Publications
| Product |
Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).
|
Alternatives
Alternatives for antigen "TSC22 Domain Family, Member 4 (TSC22D4)", type "Antibodies"
| Hosts | Rabbit (11), Mouse (3) |
| Reactivities | Human (10), Mouse (Murine) (6), Rat (Rattus) (3), Cow (Bovine) (1), Dog (Canine) (1), Pig (Porcine) (1) |
| Applications | Western Blotting (WB) (12), ELISA (6), Immunofluorescence (IF) (3), Immunohistochemistry (IHC) (2), Dot Blot (DB) (1), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (1) |
| Epitopes | N-Term (2), Internal Region (1), Middle Region (1) |
Sponsorship
2013 BioMed Central Research Awards
2013 BioMed Central Research Awards
