Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

TRM1 tRNA Methyltransferase 1-Like (TRMT1L) antibody

Antigen

TRM1 tRNA Methyltransferase 1-Like (TRMT1L)

Synonyms TRM1L, MST070, MSTP070, MGC25112, MGC57134, bG120K12.3, MGC98839, C1orf25, DKFZp459K016
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN182337
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name TRM1L
Gene ID C1ORF25
UniProt Q5XKG7
Immunogen The immunogen for anti-C1ORF25 antibody: synthetic peptide directed towards the N terminal of human C1ORF25
Sequence QAPALSPSLASAPEEAKSKRHISIQRQLADLENLAFVTDG NFDSASSLNS
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-C1ORF25 antibody concentration is 1 mg/ml.
Description Although C1orf25 is similar to N2,N2-dimethylguanosine tRNA methyltransferase from other organisms, the true function of C1orf25 protein is not known.
Characteristics Antigen Size: 546 amino acids
Molecular Weight 61kDa

Application Details

Application Notes WB Suggested Anti-C1ORF25 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives

Alternatives for antigen "TRM1 tRNA Methyltransferase 1-Like (TRMT1L)", type "Antibodies"
Hosts Rabbit (23)
Reactivities Human (23), Mouse (Murine) (18), Rat (Rattus) (18), Cow (Bovine) (1), Dog (Canine) (1)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (8), ELISA (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes Internal Region (1), N-Term (1)