Kruppel-Like Factor 9 (KLF9) antibody

Antigen: Kruppel-Like Factor 9 (KLF9)

Synonyms: BTEB, BTEB1, Bteb1, BTEB-1, AA589643, 2310051E17Rik, Bteb, bteb1-B, KLF9

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Pig (Porcine)

Conjugate: Un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN182351

Additional Information

Alternative name: KLF9

Gene ID: KLF9

UniProt: Q13886

Immunogen: The immunogen for anti-KLF9 antibody: synthetic peptide directed towards the N terminal of human KLF9

Sequence: LRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRP IQTPSVCSDS

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-KLF9 antibody concentration is 1 mg/ml.

Description: KLF9 is a transcription factor that binds to GC box elements located in the promoter. Binding of the encoded protein to a single GC box inhibits mRNA expression while binding to tandemly repeated GC box elements activates transcription.The protein encoded by this gene is a transcription factor that binds to GC box elements located in the promoter. Binding of the encoded protein to a single GC box inhibits mRNA expression while binding to tandemly repeated GC box elements activates transcription. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 244 amino acids

Molecular Weight: 27kDa

Application Details

Application Notes: WB Suggested Anti-KLF9 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-KLF9 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate

anti-Kruppel-Like Factor 9 (KLF9) antibody (Image 2)

anti-Kruppel-Like Factor 9 (KLF9) antibody (Image 3)

Publications

Product: Imataka, Nakayama, Yasumoto et al.: "Cell-specific translational control of transcription factor BTEB expression. The role of an upstream AUG in the 5'-untranslated region." in: The Journal of biological chemistry, Vol. 269, Issue 32, pp. 20668-73, 1994 (PubMed).