Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Caudal Type Homeobox 2 (CDX2) antibody

Antigen

Caudal Type Homeobox 2 (CDX2)

Synonyms CDX3, CDX-3, CDX2, CDX-2, MGC130987, cdx3-like
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Chicken

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN182373
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name Cdx2
Gene ID CDX2
UniProt Q99626
Immunogen The immunogen for anti-CDX2 antibody: synthetic peptide directed towards the middle region of human CDX2
Sequence QRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLE LEKEFHYSRY
Cross-Reactivity Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-CDX2 antibody concentration is 1 mg/ml.
Description CDX2 encodes a protein that plays an important role in gallbladder carcinogenesis with intestinal differentiation. Cdx2 is a highly sensitive marker for Barrett's esophagus.
Characteristics Antigen Size: 313 amino acids
Molecular Weight 34kDa

Application Details

Application Notes WB Suggested Anti-CDX2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Saad, Cho, Silverman et al.: "Usefulness of Cdx2 in separating mucinous bronchioloalveolar adenocarcinoma of the lung from metastatic mucinous colorectal adenocarcinoma." in: American journal of clinical pathology, Vol. 122, Issue 3, pp. 421-7, 2004 (PubMed).

Alternatives

Alternatives for antigen "Caudal Type Homeobox 2 (CDX2)", type "Antibodies"
Hosts Rabbit (53), Mouse (12), Goat (9)
Reactivities Human (69), Mouse (Murine) (34), Rat (Rattus) (33), Dog (Canine) (22), Cow (Bovine) (20), Horse (Equine) (20), Chicken (18), Pig (Porcine) (18), Monkey (2), Opossum (Didelphimorphia) (2)
Applications Western Blotting (WB) (39), ELISA (28), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (22), Immunofluorescence (IF) (16), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (5), Immunohistochemistry (IHC) (4), Immunocytochemistry (ICC) (3), Dot Blot (Dot) (1), Flow Cytometry (FACS) (1), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes N-Term (11), Internal Region (8), C-Term (3), AA 1-60 (1), AA 16-30 (1), AA 234-248 (1), AA 250-300 (1), pSer283 (1)