Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182380

OSR2 (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 5430409I15Rik, Osr2A, Osr2B
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182380
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-OSR2 antibody: synthetic peptide directed towards the N terminal of human OSR2
Sequence YSFLQAVNTFPATVDHLQGLYGLSAVQTMHMNHWTLGYPN VHEITRSTIT
Predicted Reactivity Human : 100%, African clawed frog : 92%, Bovine : 92%, Dog : 92%, Guinea pig : 92%, Horse : 92%, Mouse : 92%, Pig : 92%, Rabbit : 92%, Rat : 92%, Chicken : 85%
Characteristics This is a rabbit polyclonal antibody against OSR2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Background Osr2 is a zinc finger containing protein related to Drosophila Odd-skipped. Its mRNA expression is specifically activated in the nascent palatal mesenchyme at the onset of palatal outgrowth. Osr2 mutants exhibit altered gene expression patterns, including those of Osr1, Pax9 and Tgfb3, during palate development.
Molecular Weight 31kDa
Gene ID 116039
NCBI Accession NP_443727, NM_053001
UniProt Q8N2R0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-OSR2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lan, Ovitt, Cho et al.: "Odd-skipped related 2 (Osr2) encodes a key intrinsic regulator of secondary palate growth and morphogenesis." in: Development (Cambridge, England), Vol. 131, Issue 13, pp. 3207-16, 2004 (PubMed).

Alternatives for antigen "OSR2", type "Antibodies"
Hosts (19)
Reactivities (19), (16), (16), (12), (12), (12)
Applications (10), (10), (7), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1), (1), (1)
Beacon