Lysine (K)-Specific Demethylase 2A (KDM2A) antibody
| Antigen | Lysine (K)-Specific Demethylase 2A (KDM2A) |
| Synonyms | FBL7, CXXC8, FBL11, FBXL11, JHDM1A, LILINA, FLJ00115, FLJ46431, KIAA1004, DKFZp434M1735, Fbl7, Cxxc8, Fbl11, Jhdm1, Fbxl11, Jhdm1a, lalina, AA589516, AW536790 |
| Clonality | Polyclonal |
| Host |
 Alternatives Rabbit |
| Reactivity |
Alternatives Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Zebrafish |
| Conjugate |
Alternatives Un-conjugated |
| Application |
Alternatives Western Blotting (WB), Immunohistochemistry (IHC) |
 |
1 reference available |
| Catalog no. | ABIN182405 |
| Quantity | 50 µg |
| Price | 317.90 $ Plus shipping costs $45.00 |
| Shipping to |
|
| Availability | Will be delivered in 2 to 3 Business Days |
Additional Information
| Alternative name | KDM2A / FBXL11 |
| Gene ID | FBXL11 |
| UniProt | Q9Y2K7-3 |
| Immunogen | The immunogen for anti-FBXL11 antibody: synthetic peptide directed towards the N terminal of human FBXL11 |
| Sequence | RIRYSQRLRGTMRRRYEDDGISDDEIEGKRTFDLEEKLHT NKYNANFVTF |
| Cross-Reactivity | Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus) |
| Format | Lyophilized |
| Reconstitution | Add 50 µl of distilled water. Final anti-FBXL11 antibody concentration is 1 mg/ml. |
| Description | FBXL11 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box). The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXL11 belongs to the Fbls class and, in addition to an F-box, contains at least 6 highly degenerated leucine-rich repeats |
| Characteristics | Antigen Size: 782 amino acids |
| Molecular Weight | 86kDa |
Application Details
| Application Notes |
WB Suggested Anti-FBXL11 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: HepG2 cell lysate. |
| Purification | Affinity Purified |
| Buffer | PBS |
| Storage (Long Term) | For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Storage (Short Term) | Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. |
| Restrictions | For Research Use only |
Images
|
WB Suggested Anti-FBXL11 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: HepG2 cell lysate anti-Lysine (K)-Specific Demethylase 2A (KDM2A) antibody (Image 2) |
Publications
| Product |
Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).
|
Alternatives
Alternatives for antigen "Lysine (K)-Specific Demethylase 2A (KDM2A)", type "Antibodies"
| Hosts | Rabbit (32), Goat (1) |
| Reactivities | Human (33), Mouse (Murine) (18), Rat (Rattus) (18) |
| Applications | Western Blotting (WB) (17), Immunofluorescence (IF) (15), ELISA (13), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (6), Immunohistochemistry (IHC) (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Frozen Sections) (IHC (fro)) (2), Dot Blot (DB) (1), Immunocytochemistry (ICC) (1), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1) |
| Conjugates | Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1) |
| Epitopes | N-Term (4), Internal Region (3), C-Term (1), Center (1) |
