Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Zinc Finger with KRAB and SCAN Domains 5 (ZKSCAN5) antibody

Antigen

Zinc Finger with KRAB and SCAN Domains 5 (ZKSCAN5)

Synonyms Zfp95, hKraba1, AI132486, AI326970
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human, Mouse (Murine)

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN182413
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name ZFP95
Gene ID ZFP95
Immunogen The immunogen for anti-ZFP95 antibody: synthetic peptide directed towards the N terminal of human ZFP95
Sequence MIMTESREVIDLDPPAETSQEQEDLFIVKVEEEDCTWMQE YNPPTFETFY
Cross-Reactivity Human, Mouse (Murine)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-ZFP95 antibody concentration is 1 mg/ml.
Description ZFP95 is a zinc finger protein of the Kruppel family. It contains a SCAN box and a KRAB A domain. A similar protein in mouse is differentially expressed in spermatogenesis.
Characteristics Antigen Size: 839 amino acids
Molecular Weight 97kDa

Application Details

Application Notes WB Suggested Anti-ZFP95 Antibody Titration: 1.0ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).

Alternatives

Alternatives for antigen "Zinc Finger with KRAB and SCAN Domains 5 (ZKSCAN5)", type "Antibodies"
Hosts Rabbit (4)
Reactivities Human (4)
Applications Western Blotting (WB) (3), ELISA (1), Immunofluorescence (IF) (1)
Epitopes N-Term (2), Internal Region (1)