Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182418

Chromosome 20 Open Reading Frame 194 (C20orf194) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C20orf194
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182418
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C20ORF194 antibody: synthetic peptide directed towards the C terminal of human C20ORF194
Sequence FVNFFGDKTDFHPLMDQFMNDYVEEANREIEKYNQELEQQ EYHDLFELKP
Predicted Reactivity Human : 100%, Bovine : 92%, Chicken : 92%, Dog : 92%, Horse : 92%
Characteristics This is a rabbit polyclonal antibody against C20ORF194. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name C20ORF194
Background The function of the C20orf194 gene has not yet been determined.
Molecular Weight 99kDa
Gene ID 25943
NCBI Accession XP_045421, NM_045421
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C20ORF194 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives for antigen "Chromosome 20 Open Reading Frame 194 (C20orf194)", type "Antibodies"
Hosts (16)
Reactivities (16), (14), (13), (13), (12), (12), (12)
Applications (10), (7), (3), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2)
Beacon