Did you know that you can buy products from over 140 different suppliers from us?

Chromosome 20 Open Reading Frame 194 (C20orf194) (C-Term) antibody

Details for Product No. ABIN182418
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C20orf194
Epitope
C-Term
(2), (2)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(16), (14), (13), (13), (12), (12), (12)
Host
Rabbit
(16)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (7), (3), (3)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN182418
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human C20ORF194
Sequence FVNFFGDKTDFHPLMDQFMNDYVEEANREIEKYNQELEQQ EYHDLFELKP
Predicted Reactivity Human : 100 %, Bovine : 90 %, Chicken : 90 %, Dog : 90 %, Horse : 90 %
Characteristics This is a rabbit polyclonal antibody against C20ORF194. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name C20ORF194
Background The function of the C20orf194 gene has not yet been determined.
Molecular Weight 99 kDa
Gene ID 25943
NCBI Accession XM_045421, XP_045421
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 902 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 20 Open Reading Frame 194 (C20orf194) (C-Term) antibody WB Suggested Anti-C20ORF194 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182418
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top