Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Chromosome 20 Open Reading Frame 194 (C20orf194) antibody

Antigen

Chromosome 20 Open Reading Frame 194 (C20orf194)

Synonyms MGC117480, MGC141683, DKFZp434N061
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN182418
Quantity 100 µg
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name C20orf194
Gene ID C20ORF194
Immunogen The immunogen for anti-C20ORF194 antibody: synthetic peptide directed towards the C terminal of human C20ORF194
Sequence FVNFFGDKTDFHPLMDQFMNDYVEEANREIEKYNQELEQQ EYHDLFELKP
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-C20ORF194 antibody concentration is 1 mg/ml.
Description The function of the C20orf194 gene has not yet been determined.
Characteristics Antigen Size: 902 amino acids
Molecular Weight 99kDa

Application Details

Application Notes WB Suggested Anti-C20ORF194 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives

Alternatives for antigen "Chromosome 20 Open Reading Frame 194 (C20orf194)", type "Antibodies"
Hosts Rabbit (22)
Reactivities Human (22), Cow (Bovine) (20), Mouse (Murine) (19), Rat (Rattus) (19)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (7), ELISA (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes N-Term (2), C-Term (1)