Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger and BTB Domain Containing 20 (ZBTB20) (Middle Region) antibody

Details for Product No. ABIN182421
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DPZF, HOF, ODA-8S, ZNF288, 1300017A20Rik, 7330412A13Rik, A930017C21Rik, D16Wsu73e, Oda8, Zfp288, RGD1560387
Epitope
Middle Region
(2), (1), (1), (1), (1)
Reactivity
Dog (Canine), Mouse (Murine), Rat (Rattus), Human
(20), (13), (13), (13), (12)
Host
Rabbit
(18), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(11), (10), (5), (1), (1)
Pubmed 2 references available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182421
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZBTB20
Sequence SNSSDKSVLQQPSVNTSIGQPLPSTQLYLRQTETLTSNLR MPLTLTSNTQ
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 90 %, Rabbit : 90 %, Rat : 90 %, Guinea pig : 80 %
Characteristics This is a rabbit polyclonal antibody against ZBTB20. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name ZBTB20
Background ZBTB20 is a 733-residue protein with a BTB/POZ domain at the N-terminal and 4 C2H2 zinc fingers at C-terminal. It is localized on chromosome 3. It is widely expressed in hematopoietic tissues
Molecular Weight 73 kDa
Gene ID 26137
NCBI Accession NM_015642, NP_056457
UniProt Q9HC78
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 668 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger and BTB Domain Containing 20 (ZBTB20) (Middle Region) antibody WB Suggested Anti-ZBTB20 Antibody Titration: 2.0ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
Background publications Zhang, Mi, Li et al.: "Identification and characterization of DPZF, a novel human BTB/POZ zinc finger protein sharing homology to BCL-6." in: Biochemical and biophysical research communications, Vol. 282, Issue 4, pp. 1067-73, 2001 (PubMed).

General Zhang, Sun, Chen et al.: "Repression of AIM-1 kinase mRNA as part of a program of genes regulated by Mpl ligand." in: Biochemical and biophysical research communications, Vol. 282, Issue 3, pp. 844-9, 2001 (PubMed).

Validation Images
back to top