Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182434

Zinc Finger Protein 828 (ZNF828) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C13orf8, CAMP, CHAMP, ZNF828, AA675043, AI116001, D8Ertd457e, D8Ertd569e, Zfp828, Znf828, mKIAA1802
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN182434
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C13ORF8 antibody: synthetic peptide directed towards the middle region of human C13ORF8
Sequence PAASPESRKSARTTSPEPRKPSPSESPEPWKPFPAVSPEP RRPAPAVSPG
Predicted Reactivity Human :100%,   Rat :92%,   Crab-eating macaque :92%,   Mouse :85%,  
Characteristics This is a rabbit polyclonal antibody against C13ORF8. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name C13ORF8
Background The function of the C13orf8 gene has not yet been determined.
Molecular Weight 89kDa
Gene ID 60489
NCBI Accession NP_115812, NM_032436
UniProt Q96JM3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C13ORF8 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Zinc Finger Protein 828 (ZNF828)", type "Antibodies"
Hosts (18), (1)
Reactivities (19), (13), (13), (12), (12)
Applications (10), (10), (4), (3), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (1), (1), (1), (1)
Beacon