Zinc Finger Protein 828 (ZNF828) (Middle Region) antibody

Details for Product No. ABIN182434
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C13orf8, CAMP, CHAMP, ZNF828, AA675043, AI116001, D8Ertd457e, D8Ertd569e, Zfp828, Znf828, mKIAA1802
Epitope
Middle Region
(1), (1), (1), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Human
(17), (13), (13), (12), (12)
Host
Rabbit
(16), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(10), (8), (4), (3), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN182434
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C13ORF8
Sequence PAASPESRKSARTTSPEPRKPSPSESPEPWKPFPAVSPEP RRPAPAVSPG
Predicted Reactivity Human :100 %,   Rat :90 %,   Crab-eating macaque :90 %,   Mouse :80 %,  
Characteristics This is a rabbit polyclonal antibody against C13ORF8. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name C13ORF8
Background The function of the C13orf8 gene has not yet been determined.
Molecular Weight 89 kDa
Gene ID 60489
NCBI Accession NM_032436, NP_115812
UniProt Q96JM3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 812 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 828 (ZNF828) (Middle Region) antibody WB Suggested Anti-C13ORF8 Antibody Titration: 1.0ug/ml
ELISA Titer: 1:62500
Positive Control: Daudi cell lysate
anti-Zinc Finger Protein 828 (ZNF828) (Middle Region) antibody (2) anti-Zinc Finger Protein 828 (ZNF828) (Middle Region) antibody (Image 2)
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Hosts (16), (1)
Reactivities (17), (13), (13), (12), (12)
Applications (10), (8), (4), (3), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top