Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

NGFI-A Binding Protein 1 (EGR1 Binding Protein 1) (NAB1) antibody

Antigen

NGFI-A Binding Protein 1 (EGR1 Binding Protein 1) (NAB1)

Synonyms NAB1, MGC166379, si:dkeyp-84a8.1, DKFZp459P0928, K23F3.7, K23F3_7, T5I8.11, T5I8_11
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Xenopus laevis, Dog (Canine), Zebrafish

Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN182479
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name NAB1
Gene ID NAB1
UniProt Q13506
Immunogen The immunogen for anti-NAB1 antibody: synthetic peptide directed towards the N terminal of human NAB1
Sequence ALRDWVTNPGLFNQPLTSLPVSSIPIYKLPEGSPTWLGIS CSSYERSSNA
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-NAB1 antibody concentration is 1 mg/ml.
Description NAB1 belongs to the NAB family and acts as a transcriptional repressor for zinc finger transcription factors EGR1 and EGR2.
Characteristics Antigen Size: 487 amino acids
Molecular Weight 54kDa

Application Details

Application Notes WB Suggested Anti-NAB1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Brandenberger, Wei, Zhang et al.: "Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation." in: Nature biotechnology, Vol. 22, Issue 6, pp. 707-16, 2004 (PubMed).

Alternatives

Alternatives for antigen "NGFI-A Binding Protein 1 (EGR1 Binding Protein 1) (NAB1)", type "Antibodies"
Hosts Rabbit (5), Mouse (3)
Reactivities Human (7), Chicken (2), Cow (Bovine) (2), Dog (Canine) (2), Mouse (Murine) (2), Rat (Rattus) (2), Xenopus laevis (2), Zebrafish (2), Chlamydomonas reinhardtii (C. reinhardtii) (1)
Applications Western Blotting (WB) (7), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2), Dot Blot (Dot) (1), ELISA (1), Immunocytochemistry (ICC) (1), Immunohistochemistry (IHC) (1)
Epitopes C-Term (1), N-Term (1)