Zinc Finger Protein 691 (ZNF691) (N-Term) antibody

Details for Product No. ABIN182491
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Zfp691, RGD1308150, Znf691, 6430544H17Rik, ZNF691
Epitope
N-Term
(7), (3), (3), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Cow (Bovine), Human
(19), (1), (1), (1), (1)
Host
Rabbit
(18), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(19), (9), (1)
Pubmed 1 reference available
Catalog no. ABIN182491
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF691
Sequence GSEKEQSPEPHLPEEGEGGKPWRVDDSEGSWIPPGEKEHG QESLSDELQE
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF691. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name ZNF691
Background ZNF691 may be involved in transcriptional regulation
Molecular Weight 33 kDa
Gene ID 51058
NCBI Accession NM_015911, NP_056995
UniProt Q5VV52-2
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 284 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Hosts (18), (1)
Reactivities (19), (1), (1), (1), (1)
Applications (19), (9), (1)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (7), (3), (3), (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top