Zinc Finger Protein 691 (ZNF691) antibody

Antigen: Zinc Finger Protein 691 (ZNF691)

Synonyms: Zfp691, RP11-342M1.5, RGD1308150, ZNF691, MGC139625

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine)

Application: Western Blotting (WB)

Catalog no.: ABIN182491

Additional Information

Alternative name: ZNF691

Gene ID: ZNF691

UniProt: Q5VV52-2

Immunogen: The immunogen for anti-ZNF691 antibody: synthetic peptide directed towards the N terminal of human ZNF691

Sequence: GSEKEQSPEPHLPEEGEGGKPWRVDDSEGSWIPPGEKEHG QESLSDELQE

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-ZNF691 antibody concentration is 1 mg/ml.

Description: ZNF691 may be involved in transcriptional regulation

Characteristics: Antigen Size: 284 amino acids

Molecular Weight: 33kDa

Application Details

Application Notes: WB Suggested Anti-ZNF691 Antibody Titration: 1.25ug/ml
Positive Control: Transfected 293T.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF691 Antibody Titration: 1.25ug/ml
Positive Control: Transfected 293T

Publications

Product: Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).