ALX Homeobox 4 (ALX4) antibody

Antigen: ALX Homeobox 4 (ALX4)

Synonyms: lst, KIAA1788, ALX4, im:7142878

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN182540

Additional Information

Alternative name: ALX4

Gene ID: ALX4

Immunogen: The immunogen for anti-ALX4 antibody: synthetic peptide directed towards the N terminal of human ALX4

Sequence: MESSAKMESGGAGQQPQPQPQQPFLPPAACFFATAAAAAA AAAAAAAQSA

Cross-Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ALX4 antibody concentration is 1 mg/ml.

Description: ALX4 is a member of the ALX homeobox gene family in humans. The paired-type homeodomain has been shown to mediate high-affinity sequence-specific DNA binding to palindromic elements as either homodimers or as heterodimers with other family members.

Characteristics: Antigen Size: 411 amino acids

Molecular Weight: 44kDa

Application Details

Application Notes: WB Suggested Anti-ALX4 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ALX4 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate

Publications

Product: Mavrogiannis, Antonopoulou, Baxová et al.: "Haploinsufficiency of the human homeobox gene ALX4 causes skull ossification defects." in: Nature genetics, Vol. 27, Issue 1, pp. 17-8, 2001 (PubMed).