Sirtuin 3 (SIRT3) antibody
| Antigen | Sirtuin 3 (SIRT3) |
| Synonyms | SIR2L3, MGC158774, zgc:158774, SIRT3 |
| Clonality | Polyclonal |
| Host |
 Alternatives Rabbit |
| Reactivity |
Alternatives Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Rabbit |
| Conjugate |
Alternatives Un-conjugated |
| Application |
Alternatives Western Blotting (WB), Immunohistochemistry (IHC) |
 |
1 reference available |
| Catalog no. | ABIN182557 |
| Quantity | 50 µg (Variants) |
| Price | 317.90 $ Plus shipping costs $45.00 |
| Shipping to |
|
| Availability | Will be delivered in 2 to 3 Business Days |
Additional Information
| Alternative name | SIRT3 |
| Gene ID | SIRT3 |
| UniProt | Q9NTG7 |
| Immunogen | The immunogen for anti-SIRT3 antibody: synthetic peptide directed towards the C terminal of human SIRT3 |
| Sequence | VGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLV QRETGKLDGP |
| Cross-Reactivity | Dog (Canine), Human, Mouse (Murine), Rabbit, Rat (Rattus) |
| Format | Lyophilized |
| Reconstitution | Add 50 µl of distilled water. Final anti-SIRT3 antibody concentration is 1 mg/ml. |
| Description | The SIRT3 gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. The functions of human sirtuins have not yet been determined, however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. SIRT3 encodes a protein that is included in class I of the sirtuin family. |
| Characteristics | Antigen Size: 257 amino acids |
| Molecular Weight | 28kDa |
Application Details
| Application Notes |
WB Suggested Anti-SIRT3 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Human Thymus. |
| Purification | Affinity Purified |
| Buffer | PBS |
| Storage (Long Term) | For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Storage (Short Term) | Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. |
| Research Area | Cancer, Proteases |
| Restrictions | For Research Use only |
Images
|
WB Suggested Anti-SIRT3 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Human Thymus anti-Sirtuin 3 (SIRT3) antibody (Image 2) |
Publications
| Product |
Onyango, Celic, McCaffery et al.: "SIRT3, a human SIR2 homologue, is an NAD-dependent deacetylase localized to mitochondria." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 21, pp. 13653-8, 2002 (PubMed).
|
Alternatives
Alternatives for antigen "Sirtuin 3 (SIRT3)", type "Antibodies"
| Hosts | Rabbit (45), Goat (6), Chicken (3), Mouse (1) |
| Reactivities | Human (43), Mouse (Murine) (28), Rat (Rattus) (25), Dog (Canine) (19), Pig (Porcine) (18), Cat (Feline) (1), Chicken (1), Cow (Bovine) (1), Fruit Fly (Drosophila melanogaster) (1), Rabbit (1), Xenopus laevis (1), Zebrafish (1) |
| Applications | Western Blotting (WB) (33), ELISA (24), Immunofluorescence (IF) (17), Immunohistochemistry (IHC) (9), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunocytochemistry (ICC) (2), Immunoprecipitation (IP) (2), Immunoelectron Microscopy (IEM) (1) |
| Conjugates | Biotin (4), FITC (3), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1) |
| Epitopes | C-Term (6), Internal Region (4), N-Term (2), AA 265-280 (1), AA 38-7 (1), Middle Region (1) |
Sponsorship
2013 BioMed Central Research Awards
2013 BioMed Central Research Awards
