Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Neurogenic Differentiation 6 (NEUROD6) antibody

Antigen

Neurogenic Differentiation 6 (NEUROD6)

Synonyms Atoh2, MATH2, NEX1M, Math-2, bHLHa2, nex1, Xath2, atoh2, math2, nex1m, bhlha2, math-2, neurod6-A, RGD1562793, MGC142747, MGC145341
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN182567
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name NEUROD6
Gene ID NEUROD6
UniProt Q96NK8
Immunogen The immunogen for anti-NEUROD6 antibody: synthetic peptide directed towards the N terminal of human NEUROD6
Sequence MCRKFSRECEDQKQIKKPESFSKQIVLRGKSIKRAPGEET EKEEEEEDRE
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-NEUROD6 antibody concentration is 1 mg/ml.
Description NEUROD6 contains 1 basic helix-loop-helix (bHLH) domain. It activates E box-dependent transcription in collaboration with TCF3/E47 and may be a trans-acting factor involved in the development and maintenance of the mammalian nervous system. It transactivates the promoter of its own gene.
Characteristics Antigen Size: 337 amino acids
Molecular Weight 39kDa

Application Details

Application Notes WB Suggested Anti-NEUROD6 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).

Alternatives

Alternatives for antigen "Neurogenic Differentiation 6 (NEUROD6)", type "Antibodies"
Hosts Rabbit (26), Mouse (1)
Reactivities Human (26), Mouse (Murine) (22), Cow (Bovine) (21), Rat (Rattus) (21), Monkey (18), Chicken (3), Dog (Canine) (3), Fruit Fly (Drosophila melanogaster) (2), Xenopus laevis (2)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (11), ELISA (7), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes N-Term (2), Internal Region (1)