Basic Helix-Loop-Helix Family, Member E22 (BHLHE22) antibody

Antigen: Basic Helix-Loop-Helix Family, Member E22 (BHLHE22)

Synonyms: Beta3, BHLHB5, CAGL85, TNRC20, bhlhb5, Beta3.1, MGC64225, zgc:64225, wu:fq25e11, MGC145865, Bhlhb5, BHLHE22

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Zebrafish, Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN182569

Additional Information

Alternative name: BHLHB5 / BHLHE22

Gene ID: BHLHB5

UniProt: Q8NFJ8

Immunogen: The immunogen for anti-BHLHB5 antibody: synthetic peptide directed towards the N terminal of human BHLHB5

Sequence: LPAGAALCLKYGESASRGSVAESSGGEQSPDDDSDGRCEL VLRAGVADPR

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-BHLHB5 antibody concentration is 1 mg/ml.

Description: BHLHB5 is a member of family of basic helix-loop-helix (bHLH) transcription factors. Members of this family have been implicated in many aspects of neural development, including cell growth, differentiation, and cell migration.

Characteristics: Antigen Size: 381 amino acids

Molecular Weight: 37kDa

Application Details

Application Notes: WB Suggested Anti-BHLHB5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-BHLHB5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate

Publications

Product: McLellan, Langlands, Kealey: "Exhaustive identification of human class II basic helix-loop-helix proteins by virtual library screening." in: Mechanisms of development, Vol. 119 Suppl 1, pp. S285-91, 2003 (PubMed).