Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 14 (PSMD14) antibody

Antigen

Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 14 (PSMD14)

Synonyms PAD1, POH1, RPN11
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Fruit Fly (Drosophila melanogaster), Xenopus laevis, Zebrafish

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN182575
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name PSMD14
Gene ID PSMD14
UniProt O00487
Immunogen The immunogen for anti-PSMD14 antibody: synthetic peptide directed towards the C terminal of human PSMD14
Sequence EEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCL AAMLDTVVFK
Cross-Reactivity Cow (Bovine), Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-PSMD14 antibody concentration is 1 mg/ml.
Description POH1 (pad one homolog-1) is a component of the 26S proteasome, a multiprotein complex that degrades proteins targeted for destruction by the ubiquitin pathway
Characteristics Antigen Size: 310 amino acids
Molecular Weight 35kDa

Application Details

Application Notes WB Suggested Anti-PSMD14 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Proteolysis / Ubiquitin, Proteasome
Restrictions For Research Use only

Publications

Product Spataro, Toda, Craig et al.: "Resistance to diverse drugs and ultraviolet light conferred by overexpression of a novel human 26 S proteasome subunit." in: The Journal of biological chemistry, Vol. 272, Issue 48, pp. 30470-5, 1997 (PubMed).

Alternatives

Alternatives for antigen "Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 14 (PSMD14)", type "Antibodies"
Hosts Rabbit (34), Mouse (5)
Reactivities Human (37), Mouse (Murine) (25), Rat (Rattus) (25), Cow (Bovine) (22), Horse (Equine) (18), Xenopus laevis (4), Chicken (3), Dog (Canine) (3), Fruit Fly (Drosophila melanogaster) (3), Zebrafish (2), Yeast (1)
Applications Immunofluorescence (IF) (18), Western Blotting (WB) (17), ELISA (10), Immunohistochemistry (IHC) (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoprecipitation (IP) (2), Dot Blot (Dot) (1), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (2), Regulatory Subunit 11 (2), N-Term (1), pSer428 (1)