Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Chromobox Homolog 5 (CBX5) antibody

Antigen

Chromobox Homolog 5 (CBX5)
Synonyms MGC158601, id:ibd2026, wu:fc63e02, wu:fe47g12, wu:fi03h05, zgc:158601, CBX5, cbx5, MGC64354, MGC76213, MGC89578, HP1, HP1A, Hp1a, C75991, 2610029O15Rik
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN182588
Quantity 0.1 mg
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Chromobox Homolog 5 (CBX5) antibody

anti-Chromobox Homolog 5 (CBX5) antibody (2)

Additional Information
Application Details Publications Images Alternatives back to top

Alternative name CBX5
Gene ID CBX5
UniProt P45973
Immunogen The immunogen for anti-CBX5 antibody: synthetic peptide directed towards the middle region of human CBX5
Sequence KYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKRE QSNDIARGFE
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-CBX5 antibody concentration is 1 mg/ml.
Description CBX5 is a methyl-lysine binding protein localized at heterochromatin sites, where it mediates gene silencing.
Characteristics Antigen Size: 191 amino acids
Molecular Weight 22kDa

Application Details
Publications Images Alternatives back to top

Application Notes WB Suggested Anti-CBX5 Antibody Titration: 1.25ug/ml
Positive Control: Human brain.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives back to top

Product Fujita, Watanabe, Ichimura et al.: "Methyl-CpG binding domain 1 (MBD1) interacts with the Suv39h1-HP1 heterochromatic complex for DNA methylation-based transcriptional repression." in: The Journal of biological chemistry, Vol. 278, Issue 26, pp. 24132-8, 2003 (PubMed).

Alternatives
Application Details Publications Images back to top

Alternatives for antigen "Chromobox Homolog 5 (CBX5)", type "Antibodies"
Hosts Rabbit (99), Mouse (6), Goat (5)
Reactivities Human (74), Mouse (Murine) (55), Rat (Rattus) (45), Dog (Canine) (42), Cow (Bovine) (38), Fruit Fly (Drosophila melanogaster) (31), Monkey (2), Cat (Feline) (1), Chicken (1), Hamster (1)
Applications Immunofluorescence (IF) (60), Western Blotting (WB) (50), ELISA (38), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (17), Immunohistochemistry (IHC) (14), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (12), Immunoprecipitation (IP) (8), Immunoelectron Microscopy (IEM) (4), Immunocytochemistry (ICC) (3)
Conjugates Biotin (4), Cy3 (4), Cy5 (4), Cy5.5 (4), Cy7 (4), FITC (4), Gold (4), HRP (4), PE (4), PE,Cy3 (4), PE,Cy5 (4), PE,Cy7 (4), Alexa Fluor 350 (3), Alexa Fluor 488 (3), Alexa Fluor 555 (3), Alexa Fluor 647 (3), PE,Cy5.5 (3), Alexa Flour 488 (1)
Epitopes pTyr24 (18), pTyr37 (18), pTyr43 (13), Internal Region (7), AA 150-200 (2), AA 50-100 (2), AA 175-191 (1), AA 2-191 (1), AA 67-119 (1), C-Term (1), C-Term,AA 159-186 (1), Center (1), Internal Region,AA 87-1117 (1), N-Term (1), pSer92 (1)